| Clone Name | rbart49a04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SC24A_ARATH (Q9SFU0) Protein transport protein Sec24-like At3g07100 | 30 | 4.8 | 2 | WIF1_DROME (Q9W3W5) Protein shifted precursor (WIF-1-like protein) | 29 | 6.3 | 3 | ITRY_BAUVA (P83595) Trypsin inhibitor BvTI | 29 | 6.3 | 4 | DRD2A_XENLA (P24628) D(2) dopamine receptor A (D2R-A) (D2R 1) | 29 | 8.2 | 5 | IFXA_BAUUN (P83594) Factor Xa inhibitor BuXI | 29 | 8.2 |
|---|
>SC24A_ARATH (Q9SFU0) Protein transport protein Sec24-like At3g07100| Length = 1038 Score = 29.6 bits (65), Expect = 4.8 Identities = 22/87 (25%), Positives = 38/87 (43%), Gaps = 8/87 (9%) Frame = +2 Query: 56 LNQHTRTLKSCTSAAIYTRQMTPYIHMPVAGSWSRIKWDKMNDAIP------NYIYKC-- 211 +N H+R L+ TSA ++ + H+P+ + + +P I +C Sbjct: 314 MNCHSRYLRLTTSAIPNSQSLASRWHLPLGAVVCPLAETPEGEEVPLIDFGSTGIIRCRR 373 Query: 212 CRRLVNKNECVFYDAQRSWSCSALALL 292 CR VN F D+ R W C+ ++L Sbjct: 374 CRTYVNP-FVTFTDSGRKWRCNICSML 399
>WIF1_DROME (Q9W3W5) Protein shifted precursor (WIF-1-like protein)| Length = 456 Score = 29.3 bits (64), Expect = 6.3 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -2 Query: 353 KQHRTWVCPSGGFKANFTHCKARPMLNKTSCAARRRRHIH 234 KQ C +G ++ HCK P C R+RRH+H Sbjct: 411 KQRSICKCRNGTCVSH-KHCKCHPGFYGRHCNGRKRRHVH 449
>ITRY_BAUVA (P83595) Trypsin inhibitor BvTI| Length = 174 Score = 29.3 bits (64), Expect = 6.3 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -3 Query: 220 PTTTFVDIIWYCIVHFVPLDSGPRPCYWHV 131 P + F+ W + FV P+P +WH+ Sbjct: 64 PRSLFISTSWRVTIQFVEATCIPKPSFWHI 93
>DRD2A_XENLA (P24628) D(2) dopamine receptor A (D2R-A) (D2R 1)| Length = 442 Score = 28.9 bits (63), Expect = 8.2 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = +1 Query: 1 KHKKVYIHLNSQGAILFQSKSTHTHTEELHICSYIYTANDTIYTHASSRVVVQ 159 + K+V NS+G + K TH E++ +CS +N + ++VQ Sbjct: 213 RRKRVNTKRNSRGVAVDAHKDKCTHPEDVKLCSVFVKSNGSFPADKKKVILVQ 265
>IFXA_BAUUN (P83594) Factor Xa inhibitor BuXI| Length = 172 Score = 28.9 bits (63), Expect = 8.2 Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -3 Query: 220 PTTTFVDIIWYCIVHFVPLDS-GPRPCYWHV 131 P T F+ W + F+ + + P+P YWH+ Sbjct: 63 PRTMFISTAWRVSIQFLKVPTCTPKPSYWHI 93 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,635,501 Number of Sequences: 219361 Number of extensions: 1247716 Number of successful extensions: 2904 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2837 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2904 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)