Clone Name | rbart49a01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SP2AB_THETN (Q8RAA8) Anti-sigma F factor (EC 2.7.11.1) (Stage II... | 30 | 2.7 | 2 | KCNAE_DROME (Q02280) Potassium voltage-gated channel protein eag... | 29 | 4.5 | 3 | IASPP_MOUSE (Q5I1X5) RelA-associated inhibitor (Inhibitor of ASP... | 29 | 5.9 | 4 | AAAD_MOUSE (Q99PG0) Arylacetamide deacetylase (EC 3.1.1.-) (AADAC) | 28 | 7.7 |
---|
>SP2AB_THETN (Q8RAA8) Anti-sigma F factor (EC 2.7.11.1) (Stage II sporulation| protein AB) Length = 143 Score = 30.0 bits (66), Expect = 2.7 Identities = 10/32 (31%), Positives = 22/32 (68%) Frame = +3 Query: 60 SYNNKITVINLRL*VTSHRLQIQIVNENSGID 155 +Y NKI +I +R + +++ I++++E GI+ Sbjct: 57 AYENKIGIITIRAFILDNKITIEVIDEGKGIE 88
>KCNAE_DROME (Q02280) Potassium voltage-gated channel protein eag (Ether-a-go-go| protein) Length = 1174 Score = 29.3 bits (64), Expect = 4.5 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +1 Query: 322 GAGGEGKGMTRVFFPTTMVMYPPSSSAAGDGEGDP 426 G GG G G T PTT PP ++A G G G P Sbjct: 1125 GGGGSGSGAT----PTT----PPPTTAGGSGSGTP 1151
>IASPP_MOUSE (Q5I1X5) RelA-associated inhibitor (Inhibitor of ASPP protein)| (Protein iASPP) (PPP1R13B-like protein) (NFkB-interacting protein 1) Length = 824 Score = 28.9 bits (63), Expect = 5.9 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = +1 Query: 223 SEKDHSTEATLERNTD*LCIRQVNKSHL--FQALPGAGGEGKGMTRVFFPTTMVMYPPSS 396 S KDH T ATL RN + +S + ++ G+ G + R + P + + PPSS Sbjct: 298 SGKDHLTSATLPRNYKVSPLASDRRSDVGSYRRSLGSAGPSGTLPRSWQPVSRIPMPPSS 357
>AAAD_MOUSE (Q99PG0) Arylacetamide deacetylase (EC 3.1.1.-) (AADAC)| Length = 397 Score = 28.5 bits (62), Expect = 7.7 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 105 TSHRLQIQIVNENSGIDPKFSVPRHVHVIYRT 200 T+H+L +V+ + G+ PK PR +YR+ Sbjct: 130 TAHKLDAVVVSTDYGLAPKHHFPRQFEDVYRS 161 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,136,540 Number of Sequences: 219361 Number of extensions: 1071041 Number of successful extensions: 2298 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2265 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2298 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)