Clone Name | rbart48h05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | METZ_PSEAE (P55218) O-succinylhomoserine sulfhydrylase (EC 2.5.1... | 34 | 0.13 | 2 | MEGL_PSEPU (P13254) Methionine gamma-lyase (EC 4.4.1.11) (L-meth... | 33 | 0.28 |
---|
>METZ_PSEAE (P55218) O-succinylhomoserine sulfhydrylase (EC 2.5.1.-) (OSH| sulfhydrylase) Length = 403 Score = 34.3 bits (77), Expect = 0.13 Identities = 19/45 (42%), Positives = 26/45 (57%) Frame = -1 Query: 408 STSSEMDPEDRARAGISPGLIRMSVGYNGTLEQRWAQFERALALM 274 ++ + PEDRARAGI LIR++VG L+ A R LA + Sbjct: 360 TSHGRLSPEDRARAGIGDSLIRVAVGLE-DLDDLKADMARGLAAL 403
>MEGL_PSEPU (P13254) Methionine gamma-lyase (EC 4.4.1.11) (L-methioninase)| Length = 398 Score = 33.1 bits (74), Expect = 0.28 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = -1 Query: 405 TSSEMDPEDRARAGISPGLIRMSVG 331 T S PE+RA GIS GL+R+SVG Sbjct: 355 THSSYTPEERAHYGISEGLVRLSVG 379 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,845,427 Number of Sequences: 219361 Number of extensions: 583825 Number of successful extensions: 1239 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1227 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1239 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)