| Clone Name | rbart48h02 |
|---|---|
| Clone Library Name | barley_pub |
>ASO_CUCMA (P24792) L-ascorbate oxidase precursor (EC 1.10.3.3) (Ascorbase)| (ASO) Length = 579 Score = 50.4 bits (119), Expect = 1e-06 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -3 Query: 398 HCHIEAHFFMGMGVAFEEGIERVGKLPEEITRC 300 HCHIE H MGMGV F EG+E+VG++P + C Sbjct: 536 HCHIEPHLHMGMGVVFAEGVEKVGRIPTKALAC 568
>ASO_CUCPM (P37064) L-ascorbate oxidase (EC 1.10.3.3) (Ascorbase) (ASO)| Length = 552 Score = 50.4 bits (119), Expect = 1e-06 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = -3 Query: 398 HCHIEAHFFMGMGVAFEEGIERVGKLPEEITRC 300 HCHIE H MGMGV F EG+E+VG++P + C Sbjct: 506 HCHIEPHLHMGMGVVFAEGVEKVGRIPTKALAC 538
>ASO_TOBAC (Q40588) L-ascorbate oxidase precursor (EC 1.10.3.3) (Ascorbase)| (ASO) Length = 578 Score = 47.0 bits (110), Expect = 1e-05 Identities = 19/33 (57%), Positives = 22/33 (66%) Frame = -3 Query: 398 HCHIEAHFFMGMGVAFEEGIERVGKLPEEITRC 300 HCHIE H MGMGV F EG+ V K+P+E C Sbjct: 533 HCHIEPHLHMGMGVIFAEGVHLVKKIPKEALAC 565
>ASO_CUCSA (P14133) L-ascorbate oxidase precursor (EC 1.10.3.3) (Ascorbase)| (ASO) Length = 587 Score = 46.6 bits (109), Expect = 1e-05 Identities = 19/35 (54%), Positives = 22/35 (62%) Frame = -3 Query: 398 HCHIEAHFFMGMGVAFEEGIERVGKLPEEITRCVS 294 HCHIE H MGMGV F EG+ VG +P + C S Sbjct: 542 HCHIEPHLHMGMGVVFAEGVHMVGMIPPKALACGS 576
>PRIA_LENED (Q01200) Protein priA precursor| Length = 258 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +1 Query: 280 WPPFLLTQRVISSGSLPTRSMPSSKATPMPMKKCASMWQW 399 WP T S+ T + PSS T P +C++ W W Sbjct: 96 WPTSTPTPTPSSAHHTSTHTSPSSTPTSTPPPQCSNGWDW 135
>YD506_YEAST (Q04399) Putative multicopper oxidase YDR506C (EC 1.-.-.-)| Length = 608 Score = 29.6 bits (65), Expect = 1.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 398 HCHIEAHFFMGMGVAFE 348 HCH+E H G+G+ FE Sbjct: 530 HCHVEWHMMKGLGIVFE 546
>Y1282_METJA (Q58678) Hypothetical UPF0252 protein MJ1282| Length = 352 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -3 Query: 104 LRHMLISFSLSLILQHIFQ*ANCWTINHVC 15 +R +++ F + LILQ+I+ + +NHVC Sbjct: 1 MRKIILIFFIFLILQNIYAYEKIYDVNHVC 30
>CYB_MYOYA (Q7Y8K8) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 6.9 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Frame = -1 Query: 196 FFTFNYLFSQTFTVEILSSNSLYFSFGSNRA*GICS----YPFHYL*YYNTFSSEQIVGL 29 FFTF++LF ++ GSN GI S PFH YY + + ++GL Sbjct: 178 FFTFHFLFPFIVAAMVMVHLLFLHETGSNNPTGIPSNTDMIPFHP--YY---TIKDVLGL 232 Query: 28 LIMYVQII 5 L+M ++ Sbjct: 233 LLMITALL 240
>P2Y13_HUMAN (Q9BPV8) P2Y purinoceptor 13 (P2Y13) (G-protein coupled receptor| 86) (G-protein coupled receptor 94) Length = 333 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 322 SLPTRSMPSSKATPMPMKKCASM 390 SLP + + +ATP +KKCAS+ Sbjct: 154 SLPNMILSNKEATPSSVKKCASL 176
>P2Y13_MACFA (Q9BE53) P2Y purinoceptor 13 (P2Y13) (G-protein coupled receptor| 86) (Fragment) Length = 245 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 322 SLPTRSMPSSKATPMPMKKCASM 390 SLP + + +ATP +KKCAS+ Sbjct: 66 SLPNMILSNKEATPSSVKKCASL 88 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,480,559 Number of Sequences: 219361 Number of extensions: 678774 Number of successful extensions: 1938 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1925 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1938 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)