Clone Name | rbart48h01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ELN_HUMAN (P15502) Elastin precursor (Tropoelastin) | 30 | 3.0 | 2 | RYR1_PIG (P16960) Ryanodine receptor 1 (Skeletal muscle-type rya... | 29 | 6.7 | 3 | CEFF_STRCL (P42220) Deacetoxycephalosporin C hydroxylase (EC 1.1... | 29 | 6.7 |
---|
>ELN_HUMAN (P15502) Elastin precursor (Tropoelastin)| Length = 786 Score = 30.0 bits (66), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -3 Query: 406 PGLGVGAGEPHEGAEADE 353 PGLGVGAG P GA ADE Sbjct: 598 PGLGVGAGVPGFGAGADE 615
>RYR1_PIG (P16960) Ryanodine receptor 1 (Skeletal muscle-type ryanodine| receptor) (RyR1) (RYR-1) (Skeletal muscle calcium release channel) Length = 5035 Score = 28.9 bits (63), Expect = 6.7 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 6/42 (14%) Frame = -3 Query: 415 AEPPGLGVGAGEPHEGAEADELHVQQ------DHHVGIRDGG 308 A+ G G GAGE EGA +E+ VQ+ D V + +GG Sbjct: 4399 ADGEGAGEGAGEAWEGAGDEEVAVQEAGPGGADGAVAVAEGG 4440
>CEFF_STRCL (P42220) Deacetoxycephalosporin C hydroxylase (EC 1.14.11.26)| (Deacetylcephalosporin C synthetase) (DACS) (Beta-lactam hydroxylase) Length = 317 Score = 28.9 bits (63), Expect = 6.7 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +1 Query: 22 PPHHRRKSRTGTELQNERQARAYNLRPIPSFTFGAASQDSNG 147 P HH R G ++R + + LRP F+F A S G Sbjct: 244 PRHHVRSPGAGMREGSDRTSSVFFLRPTTDFSFSVAKARSYG 285 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,697,591 Number of Sequences: 219361 Number of extensions: 792378 Number of successful extensions: 2060 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2024 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2060 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)