Clone Name | rbart48g07 |
---|---|
Clone Library Name | barley_pub |
>PSD4_ARATH (P55034) 26S proteasome non-ATPase regulatory subunit 4 (26S| proteasome regulatory subunit S5A) (Multiubiquitin chain-binding protein) Length = 386 Score = 50.4 bits (119), Expect = 2e-06 Identities = 23/45 (51%), Positives = 37/45 (82%) Frame = -3 Query: 445 QDAEASGQSDMSKVFEDRSFVTSILNSLPGVDPNDPSVKDLLASL 311 + +EA+G + + +++F++S+L+SLPGVDPNDP+VK+LLASL Sbjct: 322 ESSEATGAGN--NLLGNQAFISSVLSSLPGVDPNDPAVKELLASL 364
>PSD4_HUMAN (P55036) 26S proteasome non-ATPase regulatory subunit 4 (26S| proteasome regulatory subunit S5A) (Rpn10) (Multiubiquitin chain-binding protein) (Antisecretory factor 1) (AF) (ASF) Length = 377 Score = 40.8 bits (94), Expect = 0.002 Identities = 17/50 (34%), Positives = 32/50 (64%) Frame = -3 Query: 451 SVQDAEASGQSDMSKVFEDRSFVTSILNSLPGVDPNDPSVKDLLASLHGQ 302 ++ +E + + D V +D F+ S+L +LPGVDPN+ ++++ + SL Q Sbjct: 313 AMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLASQ 362
>PSD4_DROME (P55035) 26S proteasome non-ATPase regulatory subunit 4 (26S| proteasome regulatory subunit S5A) (Multiubiquitin chain-binding protein) (54 kDa subunit of mu particle) (p54) Length = 396 Score = 39.3 bits (90), Expect = 0.005 Identities = 17/37 (45%), Positives = 26/37 (70%) Frame = -3 Query: 418 DMSKVFEDRSFVTSILNSLPGVDPNDPSVKDLLASLH 308 D S+V D +F+ S+L +LPGVDP +V+D + SL+ Sbjct: 345 DYSEVIGDPAFLQSVLENLPGVDPQSEAVRDAVGSLN 381
>PSD4_MOUSE (O35226) 26S proteasome non-ATPase regulatory subunit 4 (26S| proteasome regulatory subunit S5A) (Rpn10) (Multiubiquitin chain-binding protein) Length = 376 Score = 38.1 bits (87), Expect = 0.011 Identities = 15/41 (36%), Positives = 27/41 (65%) Frame = -3 Query: 424 QSDMSKVFEDRSFVTSILNSLPGVDPNDPSVKDLLASLHGQ 302 + D V +D F+ S+L +LPGVDPN+ +++ ++ +L Q Sbjct: 321 EEDDYDVMQDPEFLQSVLENLPGVDPNNAAIRSVMGALASQ 361
>PSD4_SCHMA (O17453) 26S proteasome non-ATPase regulatory subunit 4 (26S| proteasome regulatory subunit S5A) Length = 420 Score = 28.9 bits (63), Expect = 6.4 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 406 VFEDRSFVTSILNSLPGVDPNDPSVKDLLASL 311 V D F+ S+L SLPGVD + V+ + +L Sbjct: 367 VMYDAEFLESVLQSLPGVDTQNEDVRKAINAL 398
>GUXC_FUSOX (P46238) Putative exoglucanase type C precursor (EC 3.2.1.91)| (Exocellobiohydrolase I) (1,4-beta-cellobiohydrolase) (Beta-glucancellobiohydrolase) Length = 514 Score = 28.5 bits (62), Expect = 8.4 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 9 ISFTFNKHKCTKNLQHVIT*DKHGGAF 89 IS F H CTK QH T D GG + Sbjct: 238 ISTAFTPHPCTKLTQHSCTGDSCGGTY 264 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,283,936 Number of Sequences: 219361 Number of extensions: 914106 Number of successful extensions: 1984 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1939 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1984 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)