| Clone Name | rbart48d10 |
|---|---|
| Clone Library Name | barley_pub |
>CPIN1_HUMAN (Q6FI81) Anamorsin (Cytokine-induced apoptosis inhibitor 1)| (CUA001) Length = 312 Score = 61.2 bits (147), Expect = 9e-10 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -2 Query: 410 PVSACGSCGLGDAFRCSTCPYRGLAPFKLGEKVTLSDNFL 291 P SACG+C LGDAFRC++CPY G+ FK GEKV LSD+ L Sbjct: 270 PKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNL 309
>YO97_CAEEL (P41847) Hypothetical protein T20B12.7| Length = 238 Score = 59.3 bits (142), Expect = 4e-09 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -2 Query: 410 PVSACGSCGLGDAFRCSTCPYRGLAPFKLGEKVTLS 303 P S+CG+C LGDAFRCSTCPY G PFK GE V +S Sbjct: 198 PKSSCGNCSLGDAFRCSTCPYLGQPPFKPGETVKIS 233
>CPIN1_MOUSE (Q8WTY4) Anamorsin (Cytokine-induced apoptosis inhibitor 1)| Length = 309 Score = 57.4 bits (137), Expect = 1e-08 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -2 Query: 410 PVSACGSCGLGDAFRCSTCPYRGLAPFKLGEKVTLSDNFL 291 P SACG+C LGDAFRC+ CPY G+ FK GE+V LS++ L Sbjct: 267 PKSACGNCYLGDAFRCANCPYLGMPAFKPGEQVLLSNSNL 306
>YK51_YEAST (P36152) Hypothetical 38.5 kDa protein in MET1-SIS2 intergenic| region Length = 348 Score = 52.8 bits (125), Expect = 3e-07 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = -2 Query: 407 VSACGSCGLGDAFRCSTCPYRGLAPFKLGEKVTL 306 V CGSC LGDAFRCS CPY GL FK G+ + L Sbjct: 308 VGGCGSCSLGDAFRCSGCPYLGLPAFKPGQPINL 341
>FIBP_ADEP3 (Q83457) Fiber protein (pIV)| Length = 448 Score = 31.6 bits (70), Expect = 0.80 Identities = 19/54 (35%), Positives = 25/54 (46%) Frame = +2 Query: 14 TVKLHARNLVAEQRGAHTIQPPL*PALDEGTDCKDTAHDMLAQATTPNALFFCC 175 T+ L+ N + GA T+ P P T TA+ +L TTPN FF C Sbjct: 235 TISLNYSNDFSVDNGALTLAPTFKP-YTLWTGASPTANVILTNTTTPNGTFFLC 287
>VIE2_NPVOP (P32511) Immediate-early protein IE-2 (Trans-activator IE-2)| Length = 405 Score = 30.4 bits (67), Expect = 1.8 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +1 Query: 265 AVRHHMSAERKLSDKVTFSPNLNGARPLYGQVLHRNASPNPQLPQ 399 AV H R+L +++T SP L P Y R+ SP+ +P+ Sbjct: 112 AVNRHERLRRELGERMTRSPTLLNYSPSYSPTSPRSRSPDLIMPE 156
>SOX_CAEEL (Q18006) Putative sarcosine oxidase (EC 1.5.3.1)| Length = 384 Score = 30.4 bits (67), Expect = 1.8 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 413 NPVSACGSCGLGDAFRCSTCPYRGLAPFKLGEKVTLSDNFLSAD 282 NP G CG G F+ + + LA G+K T+ +F SA+ Sbjct: 334 NPNILVGGCGSGSGFKVAPGIGKALAEMAAGKKTTVDVSFFSAN 377
>RGYR1_SULTO (Q971T7) Reverse gyrase 1 [Includes: Helicase (EC 3.6.1.-);| Topoisomerase (EC 5.99.1.3)] Length = 1156 Score = 30.4 bits (67), Expect = 1.8 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -2 Query: 413 NPVSACGSCGLGDAFRCSTCPYRGLAPFKLGEKVTLSDNFLSADI 279 +P+ C +CG + +TCPY G EKV + LS ++ Sbjct: 653 SPIYKCYNCGKTFTIKSNTCPYCGSVFISSSEKVVSALRKLSTEV 697
>SYQ_SHEON (Q8EG26) Glutaminyl-tRNA synthetase (EC 6.1.1.18) (Glutamine--tRNA| ligase) (GlnRS) Length = 556 Score = 28.5 bits (62), Expect = 6.7 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = +1 Query: 232 NRTRRISYPRLAVRHHMSAERKLSDKVT 315 NRTR+ + RL + + + ++RKL+D VT Sbjct: 257 NRTRQYEFSRLNLEYTLMSKRKLNDLVT 284
>RT02_MOUSE (Q924T2) Mitochondrial 28S ribosomal protein S2 (S2mt) (MRP-S2)| Length = 291 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -3 Query: 310 PCLITSSQPTYDDGRQAADMKCALF 236 PCLIT P DD QA + C LF Sbjct: 226 PCLITYPIPGNDDSPQAIQLFCKLF 250 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,669,560 Number of Sequences: 219361 Number of extensions: 1247415 Number of successful extensions: 3199 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3189 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)