Clone Name | rbart48d07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SEC16_YEAST (P48415) Multidomain vesicle coat protein | 30 | 1.3 | 2 | SYQ_XYLFA (Q9PDP1) Glutaminyl-tRNA synthetase (EC 6.1.1.18) (Glu... | 29 | 3.8 | 3 | LA_RAT (P38656) Lupus La protein homolog (La ribonucleoprotein) ... | 28 | 6.5 | 4 | TNA1_SYMTH (P31014) Tryptophanase 1 (EC 4.1.99.1) (L-tryptophan ... | 28 | 6.5 |
---|
>SEC16_YEAST (P48415) Multidomain vesicle coat protein| Length = 2195 Score = 30.4 bits (67), Expect = 1.3 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 5/70 (7%) Frame = +3 Query: 18 KVSTAKTRAAVP--PNRDKYNNI---SSNDINQTTVSAAPRREDFLRASKGKSLAHGRAS 182 K ST + RA P + DKYN++ S+D N +T A R+E+ + K Sbjct: 1959 KASTNQYRAFKPLESDADKYNDVIEDESDDDNMSTDEAKNRKEEKKNVNMKKETKPSNKD 2018 Query: 183 FMPRANSWEG 212 ++N W G Sbjct: 2019 IDDKSNGWFG 2028
>SYQ_XYLFA (Q9PDP1) Glutaminyl-tRNA synthetase (EC 6.1.1.18) (Glutamine--tRNA| ligase) (GlnRS) Length = 580 Score = 28.9 bits (63), Expect = 3.8 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 5/45 (11%) Frame = +3 Query: 87 NDINQTTVSAAPRREDFLRASKGKSLAHG-----RASFMPRANSW 206 ++I T A P ++DF+R + LAHG R F P N + Sbjct: 2 SEITSTDARAQPEKKDFIRQIIREDLAHGTHTHIRTRFPPEPNGY 46
>LA_RAT (P38656) Lupus La protein homolog (La ribonucleoprotein) (La| autoantigen homolog) Length = 415 Score = 28.1 bits (61), Expect = 6.5 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 127 AKIFSGPAKGNRSLMGGPPSCRGRTPGR 210 A+ F G KGNR G P RG+ GR Sbjct: 348 ARRFKGRGKGNRPAYAGAPKGRGQFQGR 375
>TNA1_SYMTH (P31014) Tryptophanase 1 (EC 4.1.99.1) (L-tryptophan indole-lyase| 1) (TNase 1) Length = 454 Score = 28.1 bits (61), Expect = 6.5 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = +3 Query: 36 TRAAVPPNRDKYNNISSNDINQTTVSAAPRREDFLR---ASKGKSLAHGRASFMP 191 TR A+P R Y N+ D+ +T ++A +RE+ A + K L H A F P Sbjct: 401 TRLAIP--RRVYTNLHLEDVAETVINAFQKREEIRGVKFAREPKVLRHFTAWFDP 453 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,346,978 Number of Sequences: 219361 Number of extensions: 357559 Number of successful extensions: 1217 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1216 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)