Clone Name | rbart48c11 |
---|---|
Clone Library Name | barley_pub |
>PSA6_ORYSA (Q9LSU3) Proteasome subunit alpha type 6 (EC 3.4.25.1) (20S| proteasome alpha subunit A) (20S proteasome subunit alpha-1) Length = 246 Score = 35.4 bits (80), Expect = 0.036 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 326 TTEEIDQHLTAISERD 279 TTEEIDQHLTAISERD Sbjct: 231 TTEEIDQHLTAISERD 246
>PSA6_TOBAC (Q9XG77) Proteasome subunit alpha type 6 (EC 3.4.25.1) (20S| proteasome alpha subunit A) (20S proteasome subunit alpha-1) Length = 246 Score = 34.3 bits (77), Expect = 0.080 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -2 Query: 326 TTEEIDQHLTAISERD 279 TTEEID+HLTAISERD Sbjct: 231 TTEEIDEHLTAISERD 246
>PSA6_SOYBN (O48551) Proteasome subunit alpha type 6 (EC 3.4.25.1) (20S| proteasome alpha subunit A) (20S proteasome subunit alpha-1) (Proteasome iota subunit) Length = 246 Score = 33.1 bits (74), Expect = 0.18 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = -2 Query: 326 TTEEIDQHLTAISERD 279 TT+EID+HLTAISERD Sbjct: 231 TTDEIDEHLTAISERD 246
>PSA6A_ARATH (O81146) Proteasome subunit alpha type 6-A (EC 3.4.25.1)| (Proteasome subunit alpha type 1) (20S proteasome alpha subunit A-1) (Proteasome component 1) Length = 246 Score = 32.7 bits (73), Expect = 0.23 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = -2 Query: 326 TTEEIDQHLTAISERD 279 TTEEI++HLTAISERD Sbjct: 231 TTEEIEEHLTAISERD 246
>PSA6B_ARATH (O81147) Proteasome subunit alpha type 6-B (EC 3.4.25.1)| (Proteasome subunit alpha type 1) (20S proteasome alpha subunit A-2) Length = 246 Score = 32.3 bits (72), Expect = 0.30 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = -2 Query: 323 TEEIDQHLTAISERD 279 TEEID+HLTAISERD Sbjct: 232 TEEIDEHLTAISERD 246
>GBRA4_BOVIN (P20237) Gamma-aminobutyric-acid receptor alpha-4 subunit precursor| (GABA(A) receptor) Length = 556 Score = 29.6 bits (65), Expect = 2.0 Identities = 19/54 (35%), Positives = 28/54 (51%) Frame = -3 Query: 163 LPCISRIILCVVEFATIKFDVAGSCMFGLFYFLLLSLCGAATLSMLSLAINLPK 2 +PCI +IL V F K V +FG+ L ++ TLS+ + I+LPK Sbjct: 265 IPCIMTVILSQVSFWINKESVPARTVFGITTVLTMT-----TLSISARPISLPK 313
>IPYR_PLAF7 (O77392) Probable inorganic pyrophosphatase (EC 3.6.1.1)| (Pyrophosphate phospho-hydrolase) (PPase) Length = 380 Score = 28.5 bits (62), Expect = 4.4 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 62 EKKIKQPKHATASNIKFNRSKFNHTKDDP 148 ++ IK+ + A NI+FN K N+ D+P Sbjct: 323 KETIKEHDYVNAQNIQFNYDKLNNNDDEP 351
>FGF18_RAT (O88182) Fibroblast growth factor 18 precursor (FGF-18)| Length = 207 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Frame = -3 Query: 265 CSCQCTHKLLFCF----MASQETFSESFHV*QGRRA 170 C+C C H LL CF +A++E HV RA Sbjct: 8 CTCLCLHFLLLCFQVQVLAAEENVDFRIHVENQTRA 43
>FGF18_MOUSE (O89101) Fibroblast growth factor 18 precursor (FGF-18) (zFGF5)| Length = 207 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Frame = -3 Query: 265 CSCQCTHKLLFCF----MASQETFSESFHV*QGRRA 170 C+C C H LL CF +A++E HV RA Sbjct: 8 CTCLCLHFLLLCFQVQVLAAEENVDFRIHVENQTRA 43
>TMIGD_BOVIN (Q3T113) Transmembrane and immunoglobulin domain-containing protein| precursor Length = 261 Score = 28.1 bits (61), Expect = 5.7 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -3 Query: 214 ETFSESFHV*QGRRASTLPCISRIILCVVEFATIKFDV 101 ET ++ FH+ + ST+P I CVV F T+ F V Sbjct: 201 ETKTKDFHLIVKDKGSTVPIEPIIAACVVVFLTLVFGV 238
>TAT_SIVVG (P27982) TAT protein (Transactivating regulatory protein)| Length = 119 Score = 27.7 bits (60), Expect = 7.5 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = -3 Query: 295 PLASATELCDCSCQCTHKLLFCFMASQETFSESFHV*QGRRASTLP 158 PL T C C C C H L CF+ Q+ ++H + RR P Sbjct: 22 PLKRCTNKCYCKCCCYHCQL-CFL--QKGLGVTYHAPRIRRKKIAP 64 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,561,813 Number of Sequences: 219361 Number of extensions: 789401 Number of successful extensions: 1915 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1875 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1914 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)