| Clone Name | rbart48c07 |
|---|---|
| Clone Library Name | barley_pub |
>SECA_GUITH (O78441) Preprotein translocase secA subunit| Length = 877 Score = 32.3 bits (72), Expect = 0.80 Identities = 27/65 (41%), Positives = 33/65 (50%) Frame = +3 Query: 18 NRDGPVLIRTTSDNKTKLLEKHSCPYNLPTLTNKLTHKPKW*CNVEYEAKIKVGNGRALH 197 N PVLI TTS K++LL Y +P N L KP+ NV+ EA+I GR Sbjct: 424 NLGRPVLIGTTSVEKSELLSSLLKEYGVP--HNLLNAKPE---NVQREAEIVAQAGRLGA 478 Query: 198 VTHRT 212 VT T Sbjct: 479 VTIAT 483
>FKBP3_CANGA (Q6FKH7) FK506-binding protein 3 (EC 5.2.1.8) (Peptidyl-prolyl| cis-trans isomerase) (PPIase) (Rotamase) Length = 437 Score = 30.0 bits (66), Expect = 4.0 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = -3 Query: 513 EEEDXHRQDKDEGTKAKLFRRFHQHHHAHDSENEVDEVEELARK 382 EE + +++ E + K + H HHH HD +++ D + K Sbjct: 240 EEIEASEEEESEEEEKKSKHKKHDHHHHHDHDHDHDHEHKSKNK 283 Score = 29.3 bits (64), Expect = 6.8 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 516 EEEEDXHRQDKDEGTKAKLFRRFHQHHHAHDSENE 412 E E + ++E K+K + H HHH HD +++ Sbjct: 241 EIEASEEEESEEEEKKSKHKKHDHHHHHDHDHDHD 275
>ZDH20_MOUSE (Q5Y5T1) Probable palmitoyltransferase ZDHHC20 (EC 2.3.1.-) (Zinc| finger DHHC domain-containing protein 20) (DHHC-20) Length = 380 Score = 29.6 bits (65), Expect = 5.2 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -2 Query: 217 CCVRCVTWSALPFPTFIFASYSTLHYHLGLCVSLFVRVG 101 CC R V W + F TF+ +S Y + LCVS R G Sbjct: 9 CCQRVVGWVPVLFITFVVV-WSYYAYVVELCVSTISRTG 46
>LEGB_PEA (P14594) Legumin B [Contains: Legumin B alpha chain (Legumin B| acidic chain); Legumin B beta chain (Legumin B basic chain)] (Fragment) Length = 338 Score = 29.3 bits (64), Expect = 6.8 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = -3 Query: 516 EEEEDXHRQDKDEGTKAKLFRRFHQHHHAHDSENEVDEVEE 394 EEEE H Q K+E + + R H+ H + E+E +E EE Sbjct: 53 EEEEQSHSQRKEEEEEEQEQR--HRKHSKKEDEDEDEEEEE 91
>SRCH_RABIT (P16230) Sarcoplasmic reticulum histidine-rich calcium-binding| protein precursor Length = 852 Score = 29.3 bits (64), Expect = 6.8 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -3 Query: 513 EEEDXHRQDKDEGTKAKLFRRFHQHHHAHDSENEVDEVEE 394 EEE+ D DEG + R H H E + D+ +E Sbjct: 260 EEEEDEEDDDDEGDSTESDRHQAHRHRGHREEEDEDDDDE 299
>AGL11_ARATH (Q38836) Agamous-like MADS-box protein AGL11| Length = 230 Score = 28.9 bits (63), Expect = 8.9 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 474 TKAKLFRRFHQHHHAHDSENEVDEVEELARK 382 TK R+ QHHH S +E++ +E LA + Sbjct: 169 TKVAEVERYQQHHHQMVSGSEINAIEALASR 199
>MURI_FUSNN (Q8REE6) Glutamate racemase (EC 5.1.1.3)| Length = 264 Score = 28.9 bits (63), Expect = 8.9 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = +3 Query: 48 TSDNKTKLLEKH--SCPYNLPTLTNKLTHKPKW*CNVEYEAKIKVGNGRALHVTHRTQQ 218 T DN+ +LL K+ P N TL TH P ++E KIKV + A+ + RT Q Sbjct: 160 TFDNRKELLNKYLSEIPKNADTLVLGCTHYPLIREDIEKNIKIKVVD-PAVEIVERTIQ 217 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,335,391 Number of Sequences: 219361 Number of extensions: 1088083 Number of successful extensions: 3639 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3227 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3545 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3927707336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)