| Clone Name | rbart48a03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VL1_HPV5B (P26537) Major capsid protein L1 | 31 | 1.9 | 2 | VL1_HPV05 (P06917) Major capsid protein L1 | 31 | 1.9 | 3 | DNAJ2_MYCPA (Q73T77) Chaperone protein dnaJ 2 | 29 | 5.5 | 4 | ASPA_AERSA (P31339) Microbial serine proteinase precursor (EC 3.... | 28 | 9.4 |
|---|
>VL1_HPV5B (P26537) Major capsid protein L1| Length = 525 Score = 30.8 bits (68), Expect = 1.9 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 6/52 (11%) Frame = +1 Query: 190 YDDDDDISTNYNVHSFRICRILQTPCRG------LPCRMQQQQRGKIPPIRV 327 + DD ++T+++ ++ + TPC G +PC QQ G PPI + Sbjct: 148 FSKDDRLNTSFDPKQIQMFIVGCTPCIGEHWDKAVPCAKNDQQTGLCPPIEL 199
>VL1_HPV05 (P06917) Major capsid protein L1| Length = 516 Score = 30.8 bits (68), Expect = 1.9 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 6/67 (8%) Frame = +1 Query: 145 FIHINYLQSSNEAHIYDDDDDISTNYNVHSFRICRILQTPCRG------LPCRMQQQQRG 306 F + ++SN + DD T+++ ++ + TPC G +PC QQ G Sbjct: 124 FNKVKDTENSNAYITFSKDDRQDTSFDPKQIQMFIVGCTPCIGEHWDKAVPCAENDQQTG 183 Query: 307 KIPPIRV 327 PPI + Sbjct: 184 LCPPIEL 190
>DNAJ2_MYCPA (Q73T77) Chaperone protein dnaJ 2| Length = 392 Score = 29.3 bits (64), Expect = 5.5 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -2 Query: 474 LRTDPQLADGRRVRLPGSGKRDIR 403 +R P + DG+R+RLPG G+ +R Sbjct: 244 VRIPPGVEDGQRIRLPGQGEAGLR 267
>ASPA_AERSA (P31339) Microbial serine proteinase precursor (EC 3.4.21.-)| Length = 621 Score = 28.5 bits (62), Expect = 9.4 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 393 FIRVCGLEKLYMISSPFHGDLKHPDWR 313 ++R GL + M+S F+G+ H +WR Sbjct: 541 YVRTKGLRDMRMLSHKFYGEPAHGEWR 567 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,562,071 Number of Sequences: 219361 Number of extensions: 1299289 Number of successful extensions: 3293 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3206 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3292 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)