| Clone Name | rbart46h11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PHLA1_HUMAN (Q8WV24) Pleckstrin homology-like domain family A me... | 31 | 1.0 | 2 | ATM_NEUCR (Q7RZT9) Serine/threonine-protein kinase tel-1 (EC 2.7... | 28 | 5.0 | 3 | FREM2_MOUSE (Q6NVD0) FRAS1-related extracellular matrix protein ... | 28 | 6.5 | 4 | K10_DROME (P13468) DNA-binding protein K10 (Female sterile prote... | 28 | 8.6 |
|---|
>PHLA1_HUMAN (Q8WV24) Pleckstrin homology-like domain family A member 1 (T-cell| death-associated gene 51 protein) (Apoptosis-associated nuclear protein) (Proline- and histidine-rich protein) (Proline- and glutamine-rich protein) (PQ-rich protein) Length = 259 Score = 30.8 bits (68), Expect = 1.0 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = +2 Query: 11 HPGPDSGPN*SPYTQTEHKHPSPNGLHRPDLQRRSIPPS*HGLKLKANTTHA 166 HP P S P+ P+ H HP P+ + P Q S P HG +L +T+++ Sbjct: 213 HPHPHSHPHSHPHP---HPHPHPHQIPHPHPQPHSQP---HGHRLLRSTSNS 258
>ATM_NEUCR (Q7RZT9) Serine/threonine-protein kinase tel-1 (EC 2.7.11.1)| (DNA-damage checkpoint kinase tel-1) (Telomere length regulation protein 1) (ATM homolog) Length = 2953 Score = 28.5 bits (62), Expect = 5.0 Identities = 14/49 (28%), Positives = 28/49 (57%) Frame = +3 Query: 3 LNNIQDLTLDQTEARIPKLNTSIRHLTGFTDRTFKDDQSLHLDTDLNLK 149 ++N+ + LDQT+ KL+ +++ T +D+Q L ++T L L+ Sbjct: 1798 VHNVLEYELDQTQGMKQKLSEALKEWLTSTSPAARDNQKLLINTILYLR 1846
>FREM2_MOUSE (Q6NVD0) FRAS1-related extracellular matrix protein 2 precursor (ECM3| homolog) (NV domain-containing protein 1) Length = 3160 Score = 28.1 bits (61), Expect = 6.5 Identities = 16/63 (25%), Positives = 29/63 (46%), Gaps = 6/63 (9%) Frame = +3 Query: 27 LDQTEARIPKLNTSIRHLTGFTDRTFK------DDQSLHLDTDLNLKQTRHTPTI*WRSG 188 L +TE + ++T + H++ + K + LH+ +L+ +H W SG Sbjct: 836 LRETELHVSDVDTDVTHISFTLTQAPKHGHMQISGRPLHVGGQFHLEDIKHGRISYWNSG 895 Query: 189 DES 197 DES Sbjct: 896 DES 898
>K10_DROME (P13468) DNA-binding protein K10 (Female sterile protein K10)| Length = 463 Score = 27.7 bits (60), Expect = 8.6 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +2 Query: 5 KQHPGPDSGPN*SPYTQTEHKHPSPNGLHRPDLQRRSIPPS 127 +QHP P+ SP Q +HPSPN P ++ P S Sbjct: 128 QQHPSPNQQQPPSPNQQ---QHPSPNQQQHPSPNQQQHPNS 165 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,778,030 Number of Sequences: 219361 Number of extensions: 575464 Number of successful extensions: 1156 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1155 length of database: 80,573,946 effective HSP length: 44 effective length of database: 70,922,062 effective search space used: 1702129488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)