Clone Name | rbart46f04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IL16_MACMU (O62675) Interleukin-16 precursor (IL-16) (Lymphocyte... | 31 | 0.71 | 2 | IL16_MACFA (O62676) Interleukin-16 precursor (IL-16) (Lymphocyte... | 31 | 0.71 | 3 | IL16_CERAE (O62674) Interleukin-16 precursor (IL-16) (Lymphocyte... | 31 | 0.71 | 4 | ALFC_PEA (Q01516) Fructose-bisphosphate aldolase 1, chloroplast ... | 29 | 2.7 |
---|
>IL16_MACMU (O62675) Interleukin-16 precursor (IL-16) (Lymphocyte| chemoattractant factor) (LCF) Length = 630 Score = 31.2 bits (69), Expect = 0.71 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +3 Query: 153 HPNNN*ENKTPQNDVHLIYKSSRRRLISRGNPSGTCPSWPRRS 281 HP+ N N +YKS+ R + +G P P+W R+S Sbjct: 52 HPDGNPPKLDTANGTPKVYKSADRSTVKKGPPVAPKPAWFRQS 94
>IL16_MACFA (O62676) Interleukin-16 precursor (IL-16) (Lymphocyte| chemoattractant factor) (LCF) Length = 630 Score = 31.2 bits (69), Expect = 0.71 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +3 Query: 153 HPNNN*ENKTPQNDVHLIYKSSRRRLISRGNPSGTCPSWPRRS 281 HP+ N N +YKS+ R + +G P P+W R+S Sbjct: 52 HPDGNPPKLDTANGTPKVYKSADRSTVKKGPPVAPKPAWFRQS 94
>IL16_CERAE (O62674) Interleukin-16 precursor (IL-16) (Lymphocyte| chemoattractant factor) (LCF) Length = 631 Score = 31.2 bits (69), Expect = 0.71 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +3 Query: 153 HPNNN*ENKTPQNDVHLIYKSSRRRLISRGNPSGTCPSWPRRS 281 HP+ N N +YKS+ R + +G P P+W R+S Sbjct: 52 HPDGNPPKLDTANGTPKVYKSADRSTVKKGPPVAPKPAWFRQS 94
>ALFC_PEA (Q01516) Fructose-bisphosphate aldolase 1, chloroplast precursor| (EC 4.1.2.13) (Fragment) Length = 356 Score = 29.3 bits (64), Expect = 2.7 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -1 Query: 285 GESDEAKKGMFQKGYPY 235 GES+EAKK +F KGY Y Sbjct: 340 GESEEAKKELFVKGYSY 356 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,854,113 Number of Sequences: 219361 Number of extensions: 641994 Number of successful extensions: 1159 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1159 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)