| Clone Name | rbart46f02 |
|---|---|
| Clone Library Name | barley_pub |
>HUWE1_HUMAN (Q7Z6Z7) HECT, UBA and WWE domain-containing protein 1 (EC 6.3.2.-)| (E3 ubiquitin protein ligase URE-B1) (Mcl-1 ubiquitin ligase E3) (Mule) (ARF-binding protein 1) (ARF-BP1) Length = 4374 Score = 31.2 bits (69), Expect = 1.2 Identities = 21/55 (38%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = -2 Query: 390 LRSKXXXXXTFVNATVSTPSPAPVMR-TVRLFGVDLLTAPAPRHAPEHDDYGTAK 229 LR K V T PSP PV+ T++ D+L A A HAPE D K Sbjct: 1914 LRIKGPNAVQLVKTTPLKPSPLPVIPDTIKEVIYDMLNALAAYHAPEEADKSDPK 1968
>GLGL3_ARATH (P55231) Glucose-1-phosphate adenylyltransferase large subunit 3,| chloroplast precursor (EC 2.7.7.27) (ADP-glucose synthase) (ADP-glucose pyrophosphorylase) (AGPase S) (Alpha-D-glucose-1-phosphate adenyl transferase) Length = 521 Score = 28.1 bits (61), Expect = 9.9 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 284 RRSTPKSRTVLITGAGDGVETVALTK 361 RR+ PK+ +I G GDG + LTK Sbjct: 82 RRADPKNVAAIILGGGDGAKLFPLTK 107
>AFF1_HUMAN (P51825) AF4/FMR2 family member 1 (AF-4 protein) (Proto-oncogene AF4)| (FEL protein) Length = 1210 Score = 28.1 bits (61), Expect = 9.9 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +3 Query: 75 TAMEIWKQAKHPWRKNVR*LARSAPSLCT 161 TA ++W+QA+ RKN AR + ++CT Sbjct: 1154 TAFDLWEQAEALTRKNKEFFARLSTNVCT 1182
>RD23C_ARATH (Q84L31) Putative DNA repair protein RAD23-3 (RAD23-like protein 3)| (AtRAD23-3) Length = 419 Score = 28.1 bits (61), Expect = 9.9 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 7/76 (9%) Frame = -2 Query: 348 TVSTPSPAPVMRTVRLFGVDLLTAPAPRHAP---EHDDYGTAKTN---KRSMDAT-SVAL 190 TV+TP P PV T+ + PAP AP + D YG A +N ++++T L Sbjct: 142 TVTTPIPEPVPATIS------SSTPAPDSAPVGSQGDVYGQAASNLAAGSNLESTIQQIL 195 Query: 189 TPAHAVWKKRCIDLAL 142 W + + LAL Sbjct: 196 DMGGGTWDRETVVLAL 211
>HUWE1_MOUSE (Q7TMY8) HECT, UBA and WWE domain-containing protein 1 (EC 6.3.2.-)| (E3 ubiquitin protein ligase URE-B1) (E3Histone) Length = 4377 Score = 28.1 bits (61), Expect = 9.9 Identities = 20/55 (36%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = -2 Query: 390 LRSKXXXXXTFVNATVSTPSPAPVMR-TVRLFGVDLLTAPAPRHAPEHDDYGTAK 229 LR K V T PS PV+ T++ D+L A A HAPE D K Sbjct: 1914 LRIKGPNAVQLVKTTPLKPSSLPVIPDTIKEVIYDMLNALAAYHAPEEADKSDPK 1968 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,234,153 Number of Sequences: 219361 Number of extensions: 856679 Number of successful extensions: 2452 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2405 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2451 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)