| Clone Name | rbart46d06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POF11_SCHPO (Q09855) F-box/WD-repeat protein pof11 | 32 | 0.58 | 2 | LCD1_YEAST (Q04377) DNA damage checkpoint protein LCD1 (Lethal, ... | 29 | 2.9 | 3 | HD_FUGRU (P51112) Huntingtin (Huntington disease protein homolog... | 28 | 8.4 | 4 | BUR1_ASHGO (Q75D46) Serine/threonine-protein kinase BUR1 (EC 2.7... | 28 | 8.4 |
|---|
>POF11_SCHPO (Q09855) F-box/WD-repeat protein pof11| Length = 506 Score = 31.6 bits (70), Expect = 0.58 Identities = 18/50 (36%), Positives = 28/50 (56%) Frame = +3 Query: 6 ATPNNPLITIGMGGDYRFTIQIYWCHSMGNELMNQNGSKE**VCVWTLDS 155 +T NNP I D+R T+ +C +E+M +GSK+ V VW ++S Sbjct: 202 STFNNPSIRFPADQDFRATLDSVYCVQYDDEIM-VSGSKDRTVSVWDVNS 250
>LCD1_YEAST (Q04377) DNA damage checkpoint protein LCD1 (Lethal,| checkpoint-defective, DNA damage sensitive protein 1) (DNA damage checkpoint protein 2) Length = 747 Score = 29.3 bits (64), Expect = 2.9 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -2 Query: 143 PDAYSLFLRSILIHQLVAHRVAPVDL 66 PD SLFL SIL+HQ++ ++ +++ Sbjct: 200 PDETSLFLESILLHQIIGADLSTIEI 225
>HD_FUGRU (P51112) Huntingtin (Huntington disease protein homolog) (HD| protein) Length = 3148 Score = 27.7 bits (60), Expect = 8.4 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +2 Query: 59 YNSNLLVPLDGQRADESKWIEGIMSMRLDSG 151 +NS L PLDG RA+E ++I ++ +D G Sbjct: 689 FNSLYLEPLDGLRAEEQQYISDVLGF-IDHG 718
>BUR1_ASHGO (Q75D46) Serine/threonine-protein kinase BUR1 (EC 2.7.11.22) (EC| 2.7.11.23) Length = 753 Score = 27.7 bits (60), Expect = 8.4 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +1 Query: 37 GWAGITDLQFKSTGATRWATS**IKMDRRNNEYASGLWIVPCMFA 171 G AG TD ++ S TRW + + + +N A +W + C+FA Sbjct: 237 GGAG-TDAKYTSVVVTRWYRAPELVLGDKNYTTAVDIWGIGCVFA 280 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,880,886 Number of Sequences: 219361 Number of extensions: 526674 Number of successful extensions: 1265 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1229 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1265 length of database: 80,573,946 effective HSP length: 49 effective length of database: 69,825,257 effective search space used: 1675806168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)