| Clone Name | rbart46c07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TF3C1_HUMAN (Q12789) General transcription factor 3C polypeptide... | 30 | 2.4 | 2 | ATS18_MOUSE (Q4VC17) ADAMTS-18 precursor (EC 3.4.24.-) (A disint... | 30 | 2.4 | 3 | CS024_HUMAN (Q9BVV8) Protein C19orf24 | 30 | 3.1 | 4 | UL129_HCMVA (P16838) Hypothetical protein UL129 | 30 | 3.1 | 5 | PCNT_HUMAN (O95613) Pericentrin (Pericentrin B) (Kendrin) | 28 | 9.1 |
|---|
>TF3C1_HUMAN (Q12789) General transcription factor 3C polypeptide 1| (Transcription factor IIIC-alpha subunit) (TF3C-alpha) (TFIIIC 220 kDa subunit) (TFIIIC220) (TFIIIC box B-binding subunit) Length = 2109 Score = 30.4 bits (67), Expect = 2.4 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = +3 Query: 249 GLGDEKAREAVDAPRDRLDEQHRVVGLRRQRVLHPVQVPPGGRRVGLLP 395 G GD + + + R+ + +G+ R HP+ VP GR +G LP Sbjct: 747 GSGDSQLSASSRSESGRMKKSDNKMGITPLRNYHPIVVPGLGRSLGFLP 795
>ATS18_MOUSE (Q4VC17) ADAMTS-18 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase with thrombospondin motifs 18) (ADAM-TS 18) (ADAM-TS18) Length = 1219 Score = 30.4 bits (67), Expect = 2.4 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = +1 Query: 64 STRTPHSVCTPRRTQ*QMNPRRWSHAVPSTRALVTPAQASTKSPSMKSV-ESTCSLPPRP 240 ST T VC + +P WS + V + KSP+ +++ ES CS PRP Sbjct: 978 STPTQVQVCNSHACPPEWSPSPWSQCSKTCGRGVRRREVLCKSPAAETLPESLCSSSPRP 1037
>CS024_HUMAN (Q9BVV8) Protein C19orf24| Length = 132 Score = 30.0 bits (66), Expect = 3.1 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +1 Query: 121 PRRWSHAVPSTRALVTPAQASTKSPSMKSVESTCSL 228 PR WSH VP+ L+ PAQ + P + CSL Sbjct: 26 PRGWSHPVPTRELLLEPAQPADLLPPAPTA-GPCSL 60
>UL129_HCMVA (P16838) Hypothetical protein UL129| Length = 116 Score = 30.0 bits (66), Expect = 3.1 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = -3 Query: 467 GYLRDNWINTDLPEKKLDGNLASLGQQPDPAAARRHLYRVENTLTP 330 G L+ + P+ LD +A++G QP A ARR + R+ P Sbjct: 21 GILKTARHESQRPDAVLDDVVAAIGSQPRAAGARRRMLRIHKRQPP 66
>PCNT_HUMAN (O95613) Pericentrin (Pericentrin B) (Kendrin)| Length = 3336 Score = 28.5 bits (62), Expect = 9.1 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +3 Query: 219 LQLAAEAPGEGLGDEKAREAVDAPRDRLDEQHRVVGLRRQRVL 347 L+ E PG L AR A + D L EQ R + RQR+L Sbjct: 2941 LESKDEVPGSRLHLGSARRAAGSDADHLREQQRELEAMRQRLL 2983 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,089,806 Number of Sequences: 219361 Number of extensions: 794924 Number of successful extensions: 2879 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2877 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)