Clone Name | rbart46c03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SDK1_HUMAN (Q7Z5N4) Protein sidekick-1 precursor | 30 | 1.7 | 2 | RS30_ARATH (P49689) 40S ribosomal protein S30 | 29 | 3.0 | 3 | TNR6A_HUMAN (Q8NDV7) Trinucleotide repeat-containing gene 6A pro... | 28 | 8.6 |
---|
>SDK1_HUMAN (Q7Z5N4) Protein sidekick-1 precursor| Length = 2213 Score = 30.0 bits (66), Expect = 1.7 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 6/67 (8%) Frame = +1 Query: 16 ISITNTTVNYRHLIRSSS*HAYGNGPKATGEQANKQKRRGSA------RPAGSTTSPTSW 177 + + N T + ++L+ S+ +A G+GPK+ +Q + A STT SW Sbjct: 1763 VRLKNLTSHTKYLVSISAFNAAGDGPKSDPQQGRTHQAAPGAPSFLAFSEITSTTLNVSW 1822 Query: 178 GHASCRN 198 G + N Sbjct: 1823 GEPAAAN 1829
>RS30_ARATH (P49689) 40S ribosomal protein S30| Length = 62 Score = 29.3 bits (64), Expect = 3.0 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 196 FGKKRGPNSSEK 161 FGKKRGPNSSEK Sbjct: 51 FGKKRGPNSSEK 62
>TNR6A_HUMAN (Q8NDV7) Trinucleotide repeat-containing gene 6A protein (CAG| repeat protein 26) (Glycin-tryptophan protein of 182 kDa) (GW182 autoantigen) (GW1 protein) (EMSY interactor protein) Length = 1962 Score = 27.7 bits (60), Expect = 8.6 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = +1 Query: 85 NGPKATGEQANKQKRRGSARPAGSTTSPTSWGHASCRN 198 NGP T Q N K G + + TSWG + N Sbjct: 556 NGPMGTNFQVNTNKGGGVWESGAANSQSTSWGSGNGAN 593 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.125 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,541,773 Number of Sequences: 219361 Number of extensions: 351729 Number of successful extensions: 891 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 879 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 891 length of database: 80,573,946 effective HSP length: 41 effective length of database: 71,580,145 effective search space used: 1717923480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)