Clone Name | rbart46b12 |
---|---|
Clone Library Name | barley_pub |
>ATM_NEUCR (Q7RZT9) Serine/threonine-protein kinase tel-1 (EC 2.7.11.1)| (DNA-damage checkpoint kinase tel-1) (Telomere length regulation protein 1) (ATM homolog) Length = 2953 Score = 30.8 bits (68), Expect = 1.0 Identities = 15/49 (30%), Positives = 29/49 (59%) Frame = +2 Query: 26 LNNIQDLTLDQTEARIPKLSTSIRHLTGFTDRTSKDDQSLHLDTDLNLK 172 ++N+ + LDQT+ KLS +++ T ++D+Q L ++T L L+ Sbjct: 1798 VHNVLEYELDQTQGMKQKLSEALKEWLTSTSPAARDNQKLLINTILYLR 1846
>PHLA1_HUMAN (Q8WV24) Pleckstrin homology-like domain family A member 1 (T-cell| death-associated gene 51 protein) (Apoptosis-associated nuclear protein) (Proline- and histidine-rich protein) (Proline- and glutamine-rich protein) (PQ-rich protein) Length = 259 Score = 30.8 bits (68), Expect = 1.0 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = +1 Query: 34 HPGPDSGPN*SPYTQTEHKHPSPNGLHRPDLQRRSIPPS*HGLKLKANTTHA 189 HP P S P+ P+ H HP P+ + P Q S P HG +L +T+++ Sbjct: 213 HPHPHSHPHSHPHP---HPHPHPHQIPHPHPQPHSQP---HGHRLLRSTSNS 258
>K10_DROME (P13468) DNA-binding protein K10 (Female sterile protein K10)| Length = 463 Score = 28.9 bits (63), Expect = 3.8 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +1 Query: 22 KLKQHPGPDSGPN*SPYTQTEHKHPSPNGLHRPDLQRRSIPPS 150 K +QHP P+ SP Q +HPSPN P ++ P S Sbjct: 126 KQQQHPSPNQQQPPSPNQQ---QHPSPNQQQHPSPNQQQHPNS 165
>ISPZ_HAEDU (Q7VKZ1) Probable intracellular septation protein| Length = 183 Score = 28.5 bits (62), Expect = 5.0 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -3 Query: 111 KPVR*RMLVLSLGIRASVWSRVR-SWMLFKFICLLL 7 KPV +L L + VW+R+ W +F IC+L+ Sbjct: 98 KPVVKMLLAKELSLPTQVWNRLNLGWAIFFIICMLI 133
>CRK_XENLA (P87378) SH2/SH3 adaptor crk (Adapter molecule crk) (CRK2)| Length = 296 Score = 28.1 bits (61), Expect = 6.5 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 19 NKLKQHPGPDSGPN*SPYTQTEHKHPSPNGLHRPDLQR 132 N+ HP P GP PY Q P PN + P R Sbjct: 197 NQENSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIFAR 234
>XPOT_HUMAN (O43592) Exportin-T (tRNA exportin) (Exportin(tRNA))| Length = 962 Score = 27.7 bits (60), Expect = 8.5 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 35 IQDLTLDQTEARIPKLSTSIRHLTGFTDRTSK 130 ++ L L Q E R L+ + H GF RTSK Sbjct: 632 LEKLMLAQDEERQASLADCLNHAVGFASRTSK 663
>ARR1_ARATH (Q940D0) Two-component response regulator ARR1| Length = 690 Score = 27.7 bits (60), Expect = 8.5 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +2 Query: 44 LTLDQTEARIPKLSTSIRHLTGFTDRTSKDDQSLHLDTDLNLKQTRHT 187 LT Q+ R P LS I +GF+ R + + S L T T+H+ Sbjct: 457 LTSSQSSIRQPMLSNRISERSGFSGRNNIPESSRVLPTSYTNLTTQHS 504
>COBL6_ARATH (O04500) COBRA-like protein 6 precursor| Length = 454 Score = 27.7 bits (60), Expect = 8.5 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 83 SVWVYGLQFGPESGPGCCLSLFAYYY 6 +V VY QF P CC+SL A+YY Sbjct: 217 AVCVYS-QFRSSPSPKCCVSLSAFYY 241
>TRUB_LEGPA (Q5X1C5) tRNA pseudouridine synthase B (EC 5.4.99.-) (tRNA| pseudouridine 55 synthase) (Psi55 synthase) (tRNA-uridine isomerase) (tRNA pseudouridylate synthase) Length = 303 Score = 27.7 bits (60), Expect = 8.5 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 8 NNKQINLNNIQDLTLDQTEARIPKLSTSIRHLT 106 NN+ L+ +QD+ L Q A + + +I+HLT Sbjct: 210 NNRMYTLDELQDMPLSQRLACLIPIDQAIQHLT 242 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,669,945 Number of Sequences: 219361 Number of extensions: 591876 Number of successful extensions: 1458 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1433 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1457 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)