| Clone Name | rbart46b08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FLAF_METJA (Q58307) Putative flagella-related protein F precursor | 30 | 1.2 | 2 | YBL2_STRCI (P33654) Hypothetical 14.2 kDa protein in blaB 3'region | 30 | 2.1 | 3 | GUDX_ECOLI (Q46915) Glucarate dehydratase-related protein (EC 4.... | 29 | 3.6 | 4 | CG24_YEAST (P24871) G2/mitotic-specific cyclin-4 | 28 | 6.2 | 5 | VE2_BPV6 (Q705F3) Regulatory protein E2 | 28 | 8.1 |
|---|
>FLAF_METJA (Q58307) Putative flagella-related protein F precursor| Length = 139 Score = 30.4 bits (67), Expect = 1.2 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = -1 Query: 107 VGFGLVVVADVFFIPLLVCGLYYYSFIPHY 18 +GF VV A V I LLVCG Y Y + Y Sbjct: 1 MGFSSVVGATVMIIALLVCGAYLYVTMDSY 30
>YBL2_STRCI (P33654) Hypothetical 14.2 kDa protein in blaB 3'region| Length = 132 Score = 29.6 bits (65), Expect = 2.1 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = -2 Query: 262 SSRPSRSRASGWCSSAWRSRTTTFSPRSCTSSPSWIASI 146 SS + S AS W AW++ + SP S SSP AS+ Sbjct: 48 SSIANGSSASSWAIRAWKTTWSRTSPNSSRSSPRSPASM 86
>GUDX_ECOLI (Q46915) Glucarate dehydratase-related protein (EC 4.2.1.-)| (GDH-RP) (GlucDRP) Length = 446 Score = 28.9 bits (63), Expect = 3.6 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +1 Query: 166 ASLCSSWVKTWSCGSSTHWSTS 231 A LC W TW C S+ H+ S Sbjct: 325 AQLCDDWGLTWGCHSNNHFDIS 346
>CG24_YEAST (P24871) G2/mitotic-specific cyclin-4| Length = 460 Score = 28.1 bits (61), Expect = 6.2 Identities = 12/56 (21%), Positives = 26/56 (46%) Frame = -2 Query: 202 TTTFSPRSCTSSPSWIASILFYSPLLLQNYSRWXXXXXXXLMYSSSPFLCVGCIII 35 TT P+ ++PSW+A+ ++ + + W Y+SS + + +I+ Sbjct: 367 TTIVEPKLVAAAPSWLAAGAYFLSRTILGSNDWSLKHVFYSGYTSSQIIPLASLIL 422
>VE2_BPV6 (Q705F3) Regulatory protein E2| Length = 435 Score = 27.7 bits (60), Expect = 8.1 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 Query: 172 LCSSWVKTWSCGSSTHWSTSRM 237 LC S TWSC ++TH S RM Sbjct: 381 LCMSTSWTWSCKTTTHKSCHRM 402 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,992,009 Number of Sequences: 219361 Number of extensions: 723989 Number of successful extensions: 2229 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2229 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)