Clone Name | rbart46a11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | INLB_LISMO (P25147) Internalin B precursor | 28 | 5.5 |
---|
>INLB_LISMO (P25147) Internalin B precursor| Length = 630 Score = 28.5 bits (62), Expect = 5.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 2 LVSLTATRDYSPLNMEHNNAREIRGTSHLPQ 94 L SL + L++EHN +I G HLPQ Sbjct: 135 LSSLKDLKKLKSLSLEHNGISDINGLVHLPQ 165 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.313 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,386,180 Number of Sequences: 219361 Number of extensions: 229106 Number of successful extensions: 583 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 583 length of database: 80,573,946 effective HSP length: 15 effective length of database: 77,283,531 effective search space used: 1854804744 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)