Clone Name | rbart45f08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PDE7B_MOUSE (Q9QXQ1) cAMP-specific 3',5'-cyclic phosphodiesteras... | 28 | 6.9 | 2 | PDE7B_HUMAN (Q9NP56) cAMP-specific 3',5'-cyclic phosphodiesteras... | 28 | 6.9 | 3 | PPIL2_HUMAN (Q13356) Peptidyl-prolyl cis-trans isomerase-like 2 ... | 28 | 9.0 |
---|
>PDE7B_MOUSE (Q9QXQ1) cAMP-specific 3',5'-cyclic phosphodiesterase 7B (EC| 3.1.4.17) Length = 446 Score = 28.1 bits (61), Expect = 6.9 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 14 GQNNPFDIKSQKHLVNIQQL*RVTITQNWIAILG 115 G N PF IK+ HL N+ Q V +W + +G Sbjct: 219 GVNQPFLIKTNHHLANLYQNMSVLENHHWRSTIG 252
>PDE7B_HUMAN (Q9NP56) cAMP-specific 3',5'-cyclic phosphodiesterase 7B (EC| 3.1.4.17) Length = 450 Score = 28.1 bits (61), Expect = 6.9 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 14 GQNNPFDIKSQKHLVNIQQL*RVTITQNWIAILG 115 G N PF IK+ HL N+ Q V +W + +G Sbjct: 219 GVNQPFLIKTNHHLANLYQNMSVLENHHWRSTIG 252
>PPIL2_HUMAN (Q13356) Peptidyl-prolyl cis-trans isomerase-like 2 (EC 5.2.1.8)| (PPIase) (Rotamase) (Cyclophilin-60) (Cyclophilin-like protein Cyp-60) Length = 520 Score = 27.7 bits (60), Expect = 9.0 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 154 GLVFMLANYLPWVAKYG 104 G+VF L N +PW+ KYG Sbjct: 58 GIVFDLLNIVPWLKKYG 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,234,677 Number of Sequences: 219361 Number of extensions: 372419 Number of successful extensions: 744 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 725 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 744 length of database: 80,573,946 effective HSP length: 28 effective length of database: 74,431,838 effective search space used: 1786364112 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)