ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart45f07 |
|---|---|
| Clone Library Name | barley_pub |
>GALM_RAT (Q66HG4) Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase)| Length = 342 Score = 73.6 bits (179), Expect = 1e-13 Identities = 33/57 (57%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -1 Query: 390 NFLNHT-KGKGGKVYEQYGGFCLETQAYPDAVNHPEFPSVTVRPGQVYKHDMLLKFS 223 NFL+ T KGK G+VY ++ GFCLETQ +PDAVN P+FP + +RPG+ Y H KFS Sbjct: 284 NFLDGTLKGKSGEVYPKHSGFCLETQNWPDAVNQPQFPPILLRPGEEYNHTTWFKFS 340
>GALM_PONPY (Q5R8U1) Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase)| Length = 342 Score = 72.0 bits (175), Expect = 3e-13 Identities = 34/57 (59%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = -1 Query: 390 NFLNHT-KGKGGKVYEQYGGFCLETQAYPDAVNHPEFPSVTVRPGQVYKHDMLLKFS 223 NFL+ T KGK G VY ++ GFCLETQ +PDAVN P FP V +RPG+ Y H KFS Sbjct: 284 NFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFS 340
>GALM_HUMAN (Q96C23) Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase)| (BLOCK25 protein) Length = 342 Score = 72.0 bits (175), Expect = 3e-13 Identities = 34/57 (59%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = -1 Query: 390 NFLNHT-KGKGGKVYEQYGGFCLETQAYPDAVNHPEFPSVTVRPGQVYKHDMLLKFS 223 NFL+ T KGK G VY ++ GFCLETQ +PDAVN P FP V +RPG+ Y H KFS Sbjct: 284 NFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFS 340
>GALM_BOVIN (Q5EA79) Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase)| Length = 342 Score = 69.3 bits (168), Expect = 2e-12 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = -1 Query: 390 NFLNHT-KGKGGKVYEQYGGFCLETQAYPDAVNHPEFPSVTVRPGQVYKHDMLLKFS 223 NFL+ T KGK G Y ++ GFCLETQ++PDAVN P FP V ++PG+ Y H KFS Sbjct: 284 NFLDGTLKGKSGAGYPKHSGFCLETQSWPDAVNQPHFPPVLLKPGEEYDHTTWFKFS 340
>GALM_MOUSE (Q8K157) Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase)| Length = 342 Score = 68.2 bits (165), Expect = 5e-12 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -1 Query: 390 NFLNHT-KGKGGKVYEQYGGFCLETQAYPDAVNHPEFPSVTVRPGQVYKHDMLLKFS 223 NFL+ T KGK G VY ++ G CLETQ +PD+VN P+FP +RPG+ Y H KFS Sbjct: 284 NFLDGTLKGKNGAVYPKHSGLCLETQNWPDSVNQPQFPPALLRPGEEYNHTTWFKFS 340
>GALM_PIG (Q9GKX6) Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase)| Length = 342 Score = 65.9 bits (159), Expect = 2e-11 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -1 Query: 390 NFLNHT-KGKGGKVYEQYGGFCLETQAYPDAVNHPEFPSVTVRPGQVYKHDMLLKFS 223 NFL+ T KGK G VY ++ GFCLETQ +P+AVN P FP V ++PG+ Y H FS Sbjct: 284 NFLDGTLKGKTGAVYPKHSGFCLETQNWPNAVNQPHFPPVLLKPGEEYNHTTWFVFS 340
>GALM_ACICA (P05149) Aldose 1-epimerase precursor (EC 5.1.3.3) (Mutarotase)| Length = 381 Score = 46.6 bits (109), Expect = 1e-05 Identities = 21/55 (38%), Positives = 28/55 (50%) Frame = -1 Query: 390 NFLNHTKGKGGKVYEQYGGFCLETQAYPDAVNHPEFPSVTVRPGQVYKHDMLLKF 226 + L + G G +Y Q LETQ +PD+ N P FPS + P Q Y + KF Sbjct: 323 HLLGNIVGANGVLYRQADALALETQHFPDSPNQPTFPSTRLNPNQTYNSVTVFKF 377
>GALM_SHIFL (P0A9C4) Aldose 1-epimerase (EC 5.1.3.3) (Mutarotase)| Length = 346 Score = 43.1 bits (100), Expect = 2e-04 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Frame = -1 Query: 390 NFLNHTKGKGGKVYEQYGGFCLETQAYPDAVNHPEF--PSVTVRPGQVY 250 NFL T +G + Y + G LE++ PD+ NHPE+ P +RPG+ Y Sbjct: 287 NFLGGTPSRGTEPYADWQGLALESEFLPDSPNHPEWPQPDCFLRPGEEY 335
>GALM_ECOLI (P0A9C3) Aldose 1-epimerase (EC 5.1.3.3) (Mutarotase)| Length = 346 Score = 43.1 bits (100), Expect = 2e-04 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Frame = -1 Query: 390 NFLNHTKGKGGKVYEQYGGFCLETQAYPDAVNHPEF--PSVTVRPGQVY 250 NFL T +G + Y + G LE++ PD+ NHPE+ P +RPG+ Y Sbjct: 287 NFLGGTPSRGTEPYADWQGLALESEFLPDSPNHPEWPQPDCFLRPGEEY 335
>GALM_HAEIN (P31765) Aldose 1-epimerase (EC 5.1.3.3) (Mutarotase)| Length = 340 Score = 40.0 bits (92), Expect = 0.001 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = -1 Query: 390 NFLNHTKGKGGKVYEQYGGFCLETQAYPDAVNHPEF 283 N+L T + G++Y + G LETQ PD NHPE+ Sbjct: 283 NYLAGTPTRNGELYADFSGIALETQCLPDTPNHPEW 318
>GAL10_KLULA (P09609) GAL10 bifunctional protein [Includes: UDP-glucose| 4-epimerase (EC 5.1.3.2) (Galactowaldenase); Aldose 1-epimerase (EC 5.1.3.3) (Mutarotase)] Length = 688 Score = 37.4 bits (85), Expect = 0.009 Identities = 19/43 (44%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -1 Query: 351 YEQYGGFCLETQAYPDAVNHPEFPSVTVRP-GQVYKHDMLLKF 226 YE G C E Y DAVN+PE+ S V P G+ Y H + F Sbjct: 643 YENRAGICCEPGRYIDAVNNPEWKSSVVLPAGETYGHKLSYTF 685
>Y693_HELHP (Q7U326) Hypothetical RNA methyltransferase HH_0693 (EC 2.1.1.-)| Length = 404 Score = 30.8 bits (68), Expect = 0.82 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +2 Query: 17 YALLNGYLHCTNI*IYFSNTVSVLGPRHNSIESH-ESRHLQIQSEHIYDPSTN 172 Y LLN L+ N+ N + + H S++SH ES L+IQ E Y +TN Sbjct: 120 YDLLNHKLYACNLLSSLQNEIIITLIYHKSLDSHWESLALKIQKELEYTLNTN 172
>GAL10_YEAST (P04397) GAL10 bifunctional protein [Includes: UDP-glucose| 4-epimerase (EC 5.1.3.2) (Galactowaldenase); Aldose 1-epimerase (EC 5.1.3.3) (Mutarotase)] Length = 699 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 351 YEQYGGFCLETQAYPDAVNHPEFPS-VTVRPGQVYKHDMLLKFS 223 YE GF +E Y DA+N + VT++ G+ Y ++ +FS Sbjct: 656 YEARQGFAIEPGRYIDAINQENWKDCVTLKNGETYGSKIVYRFS 699
>GALM_STRTR (P21955) Aldose 1-epimerase (EC 5.1.3.3) (Mutarotase)| Length = 348 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = -1 Query: 360 GKVYEQYGGFCLETQAYPDAVNHPEFPSVTVRPGQVYKHDM 238 GK+ ++ +E Q PDAVNH F + + G +++ Sbjct: 299 GKMAKRREAIAMEAQTLPDAVNHKGFGDIILDKGHSVNYEI 339
>CI042_RAT (Q6AYT4) Protein C9orf42 homolog| Length = 286 Score = 28.5 bits (62), Expect = 4.1 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = +3 Query: 93 HGITASSPTNRATSKSRANTSTTHQPMVVLLLPC---RSHSS 209 HG++ SSP +A + S STT LLLP R HSS Sbjct: 41 HGLSDSSPVFQAEAPSARRNSTTFPSRHGLLLPASPVRMHSS 82
>CI042_MOUSE (Q9DB52) Protein C9orf42 homolog| Length = 284 Score = 28.5 bits (62), Expect = 4.1 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = +3 Query: 93 HGITASSPTNRATSKSRANTSTTHQPMVVLLLPC---RSHSS 209 HG++ SSP +A + S STT LLLP R HSS Sbjct: 39 HGLSDSSPVFQAEAPSARRNSTTFPSRHGLLLPASPVRMHSS 80
>Y539_PYRKO (Q5JF28) Putative HTH-type transcriptional regulatory protein| TK0539 Length = 318 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 360 GKVYEQYGGFCLETQAYPDAVNHPEFPSVTVRPGQVY 250 G VYE++G + L + DA+ + E P+V G +Y Sbjct: 87 GVVYERFGIYALRPETLYDALLNNELPAVFAERGGLY 123
>SELD1_EUBAC (Q9L4E1) Selenide, water dikinase 1 (EC 2.7.9.3) (Selenophosphate| synthetase 1) (Selenium donor protein 1) Length = 347 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/23 (56%), Positives = 16/23 (69%), Gaps = 4/23 (17%) Frame = +2 Query: 143 SEHI----YDPSTNGGTIATVPQ 199 SEHI YDP T+GG + +VPQ Sbjct: 290 SEHIMDILYDPQTSGGLLVSVPQ 312
>SIGL9_HUMAN (Q9Y336) Sialic acid-binding Ig-like lectin 9 precursor (Siglec-9)| (Protein FOAP-9) Length = 463 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +2 Query: 158 DPSTNGGTIAT-VPQP*FSLS*KENLRSMSCLYTWPGLTVT 277 DPST ++ T +PQP +++ S++C T+PG +VT Sbjct: 189 DPSTTRSSVLTLIPQP------QDHGTSLTCQVTFPGASVT 223
>CRTE_PANAN (P21684) Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)| (GGPP synthetase) (Farnesyltranstransferase) Length = 302 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +2 Query: 68 SNTVSVLGPRHNSIESHESRHLQIQSEHI 154 S V++LGPR ++E +HLQ+ SEH+ Sbjct: 250 STLVNLLGPR--AVEERLRQHLQLASEHL 276
>GAL10_SCHPO (Q9HDU3) GAL10 bifunctional protein [Includes: UDP-glucose| 4-epimerase (EC 5.1.3.2) (Galactowaldenase); Aldose 1-epimerase (EC 5.1.3.3) (Mutarotase)] Length = 713 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/35 (34%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = -1 Query: 351 YEQYGGFCLETQAYPDAVNHPEF-PSVTVRPGQVY 250 ++ GFC+ET + +A+N+ ++ V +R G+VY Sbjct: 648 FQSRSGFCVETGRFINALNNEKWSKQVILRKGEVY 682
>BJSB2_TRINI (Q06343) Basic juvenile hormone-suppressible protein 2 precursor| (BJHSP2) Length = 749 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 Query: 18 MHY*TDICTAQTYEFIFQIPYPFW 89 + Y T+ TY F F + YPFW Sbjct: 223 LRYFTEDIDLNTYYFYFHVDYPFW 246
>STAR_DROME (P42519) Protein Star| Length = 597 Score = 27.7 bits (60), Expect = 6.9 Identities = 17/52 (32%), Positives = 21/52 (40%), Gaps = 6/52 (11%) Frame = -2 Query: 179 YHHWLMGRRCVRSGFGGGAIRGTRCCYA------VGPERIRYLKNKFICLCS 42 +HH L C G GGG G+ C A + P R L +CL S Sbjct: 238 HHHHLTAAGCTGGGGGGGGSGGSGSCKAKKLDPRLNPSPYRQLLPIALCLLS 289
>CI042_HUMAN (Q96E09) Protein C9orf42| Length = 287 Score = 27.3 bits (59), Expect = 9.1 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = +3 Query: 93 HGITASSPTNRATSKSRANTSTTHQPMVVLLLPC---RSHSS 209 HG++ +SP +A + S STT LLLP R HSS Sbjct: 42 HGLSDTSPVFQAEAPSARRNSTTFPSRHGLLLPASPVRMHSS 83
>FTSK2_NEIMB (Q9JZG4) DNA translocase ftsK 2| Length = 1014 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -1 Query: 369 GKGGKVYEQYGGFCLETQAYPDA--VNHPEFPSV 274 G GG VY++ +E A PDA V PE P V Sbjct: 370 GYGGPVYDETADIHIEEPAAPDAWVVEPPEVPKV 403
>FTSK2_NEIMA (Q9JUK9) DNA translocase ftsK 2| Length = 1014 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -1 Query: 369 GKGGKVYEQYGGFCLETQAYPDA--VNHPEFPSV 274 G GG VY++ +E A PDA V PE P V Sbjct: 370 GYGGPVYDETADIHIEEPAAPDAWVVEPPEVPKV 403
>TRPD_BUCAI (P57367) Anthranilate phosphoribosyltransferase (EC 2.4.2.18)| Length = 342 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 4/47 (8%) Frame = -1 Query: 372 KGKGGKVYEQY----GGFCLETQAYPDAVNHPEFPSVTVRPGQVYKH 244 KGKG K+YE+ L+ Y + + + +R G VYKH Sbjct: 278 KGKGSKLYEELIAVNVAMLLKVFGYENLKENTKLALNKIRSGDVYKH 324
>MK12_BRARE (O42376) Mitogen-activated protein kinase 12 (EC 2.7.11.24)| (Stress-activated protein kinase 3) Length = 363 Score = 27.3 bits (59), Expect = 9.1 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -3 Query: 199 LRHGSNSTTIG*WVVDVFALDLEVARFVGLDAVMPWAQNGYG 74 L+H + IG +VDVF DL + RF VMP+ G Sbjct: 76 LKHMKHDNVIG--LVDVFTADLSLDRFHDFYLVMPFMGTDLG 115
>SYV_BRUME (Q8YGX8) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 910 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = +2 Query: 125 RHLQIQSEHIYDPSTNGGTIATVPQP*FS---LS*KENLRSMSCLYTWPGLTVTD 280 RH+ I ++ DP GT+ P F+ + + NLR+++ L +T+ D Sbjct: 261 RHIPIVADDYADPEAGSGTVKITPAHDFNDFEVGKRNNLRAINILTPEAAITLKD 315
>NRDD_ECOLI (P28903) Anaerobic ribonucleoside-triphosphate reductase (EC| 1.17.4.2) Length = 712 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -1 Query: 384 LNHTKGKGGKVYEQYGGFCLETQAYPDAVNHPEFPSVT 271 LNH KG +Q C + YPD +N+ + VT Sbjct: 338 LNHKKGDPNYDIKQLALECASKRMYPDILNYDQVVKVT 375 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,563,477 Number of Sequences: 219361 Number of extensions: 1103512 Number of successful extensions: 3129 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 3060 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3129 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
