ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart45f03 |
|---|---|
| Clone Library Name | barley_pub |
>SYG1_YEAST (P40528) Protein SYG1| Length = 902 Score = 33.9 bits (76), Expect = 0.099 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -1 Query: 368 FAITALEMVRRFQWVFFRVENE 303 F + LE++RRF W+ FRVENE Sbjct: 766 FILALLEVLRRFVWIIFRVENE 787
>YID1_SCHPO (Q9UTD8) Hypothetical protein C227.01c in chromosome I| Length = 373 Score = 33.5 bits (75), Expect = 0.13 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 368 FAITALEMVRRFQWVFFRVENEWNKMTAKQNFEMSSDM 255 F + LE+ RR WVFFR+E E +K A N SD+ Sbjct: 330 FIMQFLEVFRRCVWVFFRIEAEASKSLAYVNISDRSDI 367
>PHO1_ARATH (Q8S403) Putative phosphate transporter 1| Length = 782 Score = 31.2 bits (69), Expect = 0.64 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -1 Query: 368 FAITALEMVRRFQWVFFRVENE 303 F + +LE++RR W F+RVENE Sbjct: 736 FFLASLEVIRRGHWNFYRVENE 757
>ERD1_KLULA (P41771) Protein ERD1| Length = 384 Score = 28.9 bits (63), Expect = 3.2 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = -1 Query: 368 FAITALEMVRRFQWVFFRVENEW 300 F + LE++RR+ W+FF+VE E+ Sbjct: 351 FWLQILEIIRRWIWLFFKVEVEY 373
>POLN_RUBVT (P13889) Nonstructural polyprotein [Contains: Protease (EC 3.4.22.-)| (p150); RNA-directed RNA polymerase/helicase (EC 2.7.7.48) (EC 3.6.1.-) (p90)] Length = 2115 Score = 28.5 bits (62), Expect = 4.2 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 44 LSLFGFKSVIHMAHVPTTSFCGNLSCIIGL 133 + LFGF + PT SFCG++ GL Sbjct: 1988 VGLFGFHIPVKHVSTPTPSFCGHVGTAAGL 2017
>POLN_RUBVM (Q86500) Nonstructural polyprotein [Contains: Protease (EC 3.4.22.-)| (p150); RNA-directed RNA polymerase/helicase (EC 2.7.7.48) (EC 3.6.1.-) (p90)] Length = 2115 Score = 28.5 bits (62), Expect = 4.2 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 44 LSLFGFKSVIHMAHVPTTSFCGNLSCIIGL 133 + LFGF + PT SFCG++ GL Sbjct: 1988 VGLFGFHIPVKHVSTPTPSFCGHVGTAAGL 2017
>AHM7_ARATH (Q9SH30) Putative copper-transporting ATPase 3 (EC 3.6.3.4)| Length = 995 Score = 28.1 bits (61), Expect = 5.5 Identities = 17/38 (44%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +1 Query: 205 QTVWLLESNSLS-ASEGSISDDISKFCLAVILFHSFST 315 Q V L+ES L+ A ++D ISKF + +++F SFST Sbjct: 540 QIVRLVESAQLAKAPVQKLADRISKFFVPLVIFLSFST 577
>L_RABVS (P16289) Large structural protein (L protein) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2127 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -1 Query: 314 VENEWNKMTAKQNFEMSSDMLPSEADRLLDSNSHT 210 V + W+K+ Q FE+ M PSE +LD SH+ Sbjct: 453 VGDTWHKLPITQIFEIPESMDPSE---ILDDKSHS 484
>VSH_MUMPL (P28083) Small hydrophobic protein| Length = 57 Score = 27.3 bits (59), Expect = 9.3 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 40 ITITVWIQECYTYGTCANNFVLWKSILYNW 129 IT+ VW+ TY T + L++ L+ W Sbjct: 22 ITLYVWVVSTITYKTAVRHAALYQRSLFRW 51
>VSH_MUMPB (P28082) Small hydrophobic protein| Length = 57 Score = 27.3 bits (59), Expect = 9.3 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 40 ITITVWIQECYTYGTCANNFVLWKSILYNW 129 IT+ VW+ TY T + L++ L+ W Sbjct: 22 ITLYVWVVSTITYKTAVRHAALYQRSLFRW 51
>SYL_MYCTU (P67510) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 969 Score = 27.3 bits (59), Expect = 9.3 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -1 Query: 368 FAITALEMVRRFQWVFFRVENEWNKMTAKQ 279 F+ T ++ R QW+F ++ N W TA + Sbjct: 162 FSTTDVDFYRWTQWIFLQIYNAWFDTTANK 191
>SYL_MYCBO (P67511) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 969 Score = 27.3 bits (59), Expect = 9.3 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -1 Query: 368 FAITALEMVRRFQWVFFRVENEWNKMTAKQ 279 F+ T ++ R QW+F ++ N W TA + Sbjct: 162 FSTTDVDFYRWTQWIFLQIYNAWFDTTANK 191
>L_RABVP (P11213) Large structural protein (L protein) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2142 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -1 Query: 314 VENEWNKMTAKQNFEMSSDMLPSEADRLLDSNSHT 210 V + W+K+ Q FE+ M PSE +LD SH+ Sbjct: 453 VGDTWHKLPITQIFEIPESMDPSE---ILDDKSHS 484
>DIP2C_HUMAN (Q9Y2E4) Disco-interacting protein 2 homolog C| Length = 1556 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = +2 Query: 14 PNSITCLLILLSLFGFKSVIHMAHVPTTSFCGNLSCIIGLLSSRDV 151 P+++ L +S G + + M+H T++FC ++ L SR+V Sbjct: 1131 PDTLAYLDFSVSTTGMLAGVKMSHAATSAFCRSIKLQCELYPSREV 1176
>MK08B_CYPCA (O42099) Mitogen-activated protein kinase 8B (EC 2.7.11.24)| (Stress-activated protein kinase JNKb) (c-Jun N-terminal kinase B) Length = 427 Score = 27.3 bits (59), Expect = 9.3 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = -1 Query: 359 TALEMVRRFQWVFFRVENEWNKMTAKQNFEMSSDMLPSEADRLLDSNSHTV*PYI 195 T + F V F ++E NK+ A Q ++ S ML +A + + + PYI Sbjct: 267 TGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYI 321 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,314,490 Number of Sequences: 219361 Number of extensions: 1055936 Number of successful extensions: 2452 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 2416 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2452 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
