| Clone Name | rbart45e04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ERI1_ASHGO (Q75D30) Phosphatidylinositol N-acetylglucosaminyltra... | 32 | 0.52 | 2 | UTP20_MOUSE (Q5XG71) Small subunit processome component 20 homol... | 32 | 0.52 | 3 | UTP20_HUMAN (O75691) Small subunit processome component 20 homol... | 30 | 2.0 | 4 | 6PGL_RHILO (Q989A3) 6-phosphogluconolactonase (EC 3.1.1.31) (6PGL) | 28 | 7.6 |
|---|
>ERI1_ASHGO (Q75D30) Phosphatidylinositol N-acetylglucosaminyltransferase ERI1| subunit (Endoplasmic reticulum-associated Ras inhibitor protein 1) Length = 71 Score = 32.3 bits (72), Expect = 0.52 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = -1 Query: 195 RVSSRIVTQFQESASDALFFATSYLEHQETTLFVWCF*NFREIKQWCWLV 46 +V++ +V S A + +Y H ET L+ WC + W W V Sbjct: 4 KVAATLVLVVTYSIVGASLWCLTYAWHDETKLYYWCIVQLLPVMLWVWCV 53
>UTP20_MOUSE (Q5XG71) Small subunit processome component 20 homolog| (Down-regulated in metastasis protein) Length = 2788 Score = 32.3 bits (72), Expect = 0.52 Identities = 17/64 (26%), Positives = 29/64 (45%) Frame = -1 Query: 201 VCRVSSRIVTQFQESASDALFFATSYLEHQETTLFVWCF*NFREIKQWCWLVGTKYVGSA 22 V +++ + T F D TS LE Q+T L W F + + ++ W + K + Sbjct: 111 VVQLARDLQTDFYPHFEDFFLTITSILETQDTELLEWAFTSLSYLYKYLWRLMVKDMSKI 170 Query: 21 YSRF 10 YS + Sbjct: 171 YSLY 174
>UTP20_HUMAN (O75691) Small subunit processome component 20 homolog| (Down-regulated in metastasis protein) (Protein Key-1A6) (Novel nucleolar protein 73) (NNP73) Length = 2785 Score = 30.4 bits (67), Expect = 2.0 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -1 Query: 132 TSYLEHQETTLFVWCF*NFREIKQWCWLVGTKYVGSAYSRF 10 TS LE Q+T L W F + + ++ W + K + S YS + Sbjct: 134 TSILETQDTELLEWAFTSLSYLYKYLWRLMVKDMSSIYSMY 174
>6PGL_RHILO (Q989A3) 6-phosphogluconolactonase (EC 3.1.1.31) (6PGL)| Length = 238 Score = 28.5 bits (62), Expect = 7.6 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 413 PVDIVVFRVGTPGHDRLLFPDLD 345 P+D+VV +G GH FPD D Sbjct: 134 PLDVVVLGMGPDGHTASFFPDAD 156 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,883,646 Number of Sequences: 219361 Number of extensions: 1316057 Number of successful extensions: 2671 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2635 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2671 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)