ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart45d09 |
|---|---|
| Clone Library Name | barley_pub |
>METK_HORVU (P50299) S-adenosylmethionine synthetase 1 (EC 2.5.1.6) (Methionine| adenosyltransferase 1) (AdoMet synthetase 1) Length = 394 Score = 52.4 bits (124), Expect = 6e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLKFDKASA 415 FGRDDADFTWEVVKPLKFDKASA Sbjct: 372 FGRDDADFTWEVVKPLKFDKASA 394
>METL_LYCES (P43281) S-adenosylmethionine synthetase 2 (EC 2.5.1.6) (Methionine| adenosyltransferase 2) (AdoMet synthetase 2) Length = 393 Score = 45.1 bits (105), Expect = 1e-04 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLKFDKASA 415 FGRDD DFTWEVVKPLK+DK A Sbjct: 371 FGRDDPDFTWEVVKPLKWDKPEA 393
>METL_ARATH (P17562) S-adenosylmethionine synthetase 2 (EC 2.5.1.6) (Methionine| adenosyltransferase 2) (AdoMet synthetase 2) Length = 393 Score = 45.1 bits (105), Expect = 1e-04 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLKFDKASA 415 FGRDD DFTWEVVKPLK+DK A Sbjct: 371 FGRDDPDFTWEVVKPLKWDKPQA 393
>METK_BRAJU (P49611) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) Length = 393 Score = 45.1 bits (105), Expect = 1e-04 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLKFDKASA 415 FGRDD DFTWEVVKPLK+DK A Sbjct: 371 FGRDDPDFTWEVVKPLKWDKPQA 393
>METK_ARATH (P23686) S-adenosylmethionine synthetase 1 (EC 2.5.1.6) (Methionine| adenosyltransferase 1) (AdoMet synthetase 1) Length = 393 Score = 45.1 bits (105), Expect = 1e-04 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLKFDKASA 415 FGRDD DFTWEVVKPLK+DK A Sbjct: 371 FGRDDPDFTWEVVKPLKWDKPQA 393
>METL_ORYSA (P93438) S-adenosylmethionine synthetase 2 (EC 2.5.1.6) (Methionine| adenosyltransferase 2) (AdoMet synthetase 2) Length = 394 Score = 45.1 bits (105), Expect = 1e-04 Identities = 18/23 (78%), Positives = 22/23 (95%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLKFDKASA 415 FGR+D DFTWEVVKPLK++KAS+ Sbjct: 372 FGREDPDFTWEVVKPLKYEKASS 394
>METK_ORYSA (P46611) S-adenosylmethionine synthetase 1 (EC 2.5.1.6) (Methionine| adenosyltransferase 1) (AdoMet synthetase 1) Length = 396 Score = 45.1 bits (105), Expect = 1e-04 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLKFDKASA 415 FGRDD DFTWEVVKPLK++K SA Sbjct: 374 FGRDDPDFTWEVVKPLKWEKPSA 396
>METL_CATRO (Q96552) S-adenosylmethionine synthetase 2 (EC 2.5.1.6) (Methionine| adenosyltransferase 2) (AdoMet synthetase 2) Length = 393 Score = 44.3 bits (103), Expect = 2e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLKFDKASA 415 FGR+D DFTWEVVKPLKF+K A Sbjct: 371 FGREDPDFTWEVVKPLKFEKVEA 393
>METK_CATRO (Q96551) S-adenosylmethionine synthetase 1 (EC 2.5.1.6) (Methionine| adenosyltransferase 1) (AdoMet synthetase 1) Length = 393 Score = 44.3 bits (103), Expect = 2e-04 Identities = 18/22 (81%), Positives = 21/22 (95%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLKFDKAS 418 FGRDD DFTWEVVKPLK++KA+ Sbjct: 371 FGRDDPDFTWEVVKPLKWEKAA 392
>METK_MESCR (P93254) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) Length = 392 Score = 44.3 bits (103), Expect = 2e-04 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLKFDK 424 FGRDDADFTWEVVKPLK++K Sbjct: 370 FGRDDADFTWEVVKPLKWEK 389
>METM_ACTCH (P50303) S-adenosylmethionine synthetase 3 (EC 2.5.1.6) (Methionine| adenosyltransferase 3) (AdoMet synthetase 3) (Fragment) Length = 360 Score = 44.3 bits (103), Expect = 2e-04 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLKFDK 424 FGRDDADFTWEVVKPLK++K Sbjct: 338 FGRDDADFTWEVVKPLKWEK 357
>METK_PINBN (P50300) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) Length = 393 Score = 43.9 bits (102), Expect = 2e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLKFDKASA 415 FGRDD DFTWE VKPLK++KA A Sbjct: 371 FGRDDPDFTWETVKPLKWEKAQA 393
>METK_LYCES (P43280) S-adenosylmethionine synthetase 1 (EC 2.5.1.6) (Methionine| adenosyltransferase 1) (AdoMet synthetase 1) Length = 393 Score = 42.4 bits (98), Expect = 7e-04 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLKFDK 424 FGRDD DFTWEVVKPLK++K Sbjct: 371 FGRDDPDFTWEVVKPLKWEK 390
>METK_PEA (P49612) S-adenosylmethionine synthetase 1 (EC 2.5.1.6) (Methionine| adenosyltransferase 1) (AdoMet synthetase 1) (Fragment) Length = 366 Score = 42.4 bits (98), Expect = 7e-04 Identities = 17/21 (80%), Positives = 20/21 (95%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLKFDKA 421 FGR+D DFTWEVVKPLK++KA Sbjct: 346 FGREDPDFTWEVVKPLKWEKA 366
>METL_PETCR (P31156) S-adenosylmethionine synthetase 2 (EC 2.5.1.6) (Methionine| adenosyltransferase 2) (AdoMet synthetase 2) (Fragment) Length = 145 Score = 42.4 bits (98), Expect = 7e-04 Identities = 17/21 (80%), Positives = 20/21 (95%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLKFDKA 421 FGR+D DFTWEVVKPLK++KA Sbjct: 125 FGREDPDFTWEVVKPLKWEKA 145
>METK_PETCR (P31155) S-adenosylmethionine synthetase 1 (EC 2.5.1.6) (Methionine| adenosyltransferase 1) (AdoMet synthetase 1) (Fragment) Length = 234 Score = 42.4 bits (98), Expect = 7e-04 Identities = 17/21 (80%), Positives = 20/21 (95%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLKFDKA 421 FGR+D DFTWEVVKPLK++KA Sbjct: 214 FGREDPDFTWEVVKPLKWEKA 234
>METK_MUSAC (O22338) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) Length = 393 Score = 42.0 bits (97), Expect = 9e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLKFDKASA 415 FGRDD DFTWEVVKPL+ +K +A Sbjct: 371 FGRDDPDFTWEVVKPLELEKPAA 393
>METK_POPDE (P47916) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) Length = 395 Score = 42.0 bits (97), Expect = 9e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLKFD 427 FGRDD DFTWEVVKPLK+D Sbjct: 372 FGRDDPDFTWEVVKPLKWD 390
>METL_DIACA (P24260) S-adenosylmethionine synthetase 2 (EC 2.5.1.6) (Methionine| adenosyltransferase 2) (AdoMet synthetase 2) Length = 396 Score = 35.8 bits (81), Expect = 0.061 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLKFDKASA 415 FGR+D DFTWE K LK++K A Sbjct: 374 FGREDPDFTWEAAKTLKWEKPQA 396
>METM_LYCES (P43282) S-adenosylmethionine synthetase 3 (EC 2.5.1.6) (Methionine| adenosyltransferase 3) (AdoMet synthetase 3) Length = 390 Score = 34.3 bits (77), Expect = 0.18 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLK 433 FGRDD DFTWE VK LK Sbjct: 371 FGRDDPDFTWETVKVLK 387
>METK_ACTCH (P50301) S-adenosylmethionine synthetase 1 (EC 2.5.1.6) (Methionine| adenosyltransferase 1) (AdoMet synthetase 1) Length = 390 Score = 33.9 bits (76), Expect = 0.23 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLK 433 FGRDD DFTWE VK LK Sbjct: 371 FGRDDPDFTWETVKILK 387
>METL_ACTCH (P50302) S-adenosylmethionine synthetase 2 (EC 2.5.1.6) (Methionine| adenosyltransferase 2) (AdoMet synthetase 2) Length = 390 Score = 33.5 bits (75), Expect = 0.30 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLK 433 FGRDDAD TWE VK LK Sbjct: 371 FGRDDADLTWETVKILK 387
>METK_PETHY (P48498) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) Length = 390 Score = 32.3 bits (72), Expect = 0.67 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -1 Query: 483 FGRDDADFTWEVVKPL 436 FGRDD DFTWE VK L Sbjct: 371 FGRDDPDFTWETVKVL 386
>METM_CATRO (Q96553) S-adenosylmethionine synthetase 3 (EC 2.5.1.6) (Methionine| adenosyltransferase 3) (AdoMet synthetase 3) Length = 390 Score = 31.6 bits (70), Expect = 1.2 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -1 Query: 480 GRDDADFTWEVVKPLK 433 GRDD DFTWE VK LK Sbjct: 372 GRDDPDFTWETVKILK 387
>DMD_CHICK (P11533) Dystrophin| Length = 3660 Score = 30.0 bits (66), Expect = 3.3 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 6/77 (7%) Frame = +1 Query: 52 LEESQFGKDRATELHKAL*TLEERAL*GETTQNRI*------KVKVTERVTEQTAHHSAV 213 L+E F KD + + + L +R G+T Q RI ++K+ +++ QT H++ Sbjct: 1809 LKEEDFNKDMSEDDESTVKELLQR---GDTLQKRITDERKREEIKIKQQLL-QTKHNALK 1864 Query: 214 SAHSKRK*KIYEMIHQY 264 S+R+ K E+ HQ+ Sbjct: 1865 DLRSQRRKKALEISHQW 1881
>CAC1S_HUMAN (Q13698) Voltage-dependent L-type calcium channel alpha-1S subunit| (Voltage-gated calcium channel alpha subunit Cav1.1) (Calcium channel, L type, alpha-1 polypeptide, isoform 3, skeletal muscle) Length = 1873 Score = 29.3 bits (64), Expect = 5.7 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -2 Query: 326 IRHHRVW---LHWSCRLVISAKFSYWCII 249 IRH R W W C ++ +K YW +I Sbjct: 411 IRHWRQWNRIFRWKCHDIVKSKVFYWLVI 439
>DPOL_HBVWJ (P17394) P protein [Includes: DNA-directed DNA polymerase (EC| 2.7.7.7); RNA-directed DNA polymerase (EC 2.7.7.49); Ribonuclease H (EC 3.1.26.4)] Length = 843 Score = 28.9 bits (63), Expect = 7.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 422 HLPKKKTSQWGYSWSAATLVQQSFGSW 342 HL KT +WGYS + V S+G+W Sbjct: 580 HLNPNKTKRWGYSLNFMGYVIGSWGTW 606
>METK_ACACA (Q95032) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) Length = 388 Score = 28.5 bits (62), Expect = 9.7 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -1 Query: 483 FGRDDADFTWEVVKPLKF 430 FGR+D DF WE K L F Sbjct: 371 FGRNDPDFLWEAPKKLNF 388
>ASPM_MOUSE (Q8CJ27) Abnormal spindle-like microcephaly-associated protein| homolog (Calmodulin-binding protein 1) (Spindle and hydroxyurea checkpoint abnormal protein) (Calmodulin-binding protein Sha1) Length = 3122 Score = 28.5 bits (62), Expect = 9.7 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Frame = -2 Query: 377 AATLVQQSFGSWEVRR---SIRHHRVWLHWSCRLVISAKFS 264 AATL+Q+ F ++ +RR S+R +W+ R + AK+S Sbjct: 2233 AATLIQRRFRTFAMRRKFLSLRKTAIWIQRQYRARLYAKYS 2273
>PLSB_XANCP (Q8P3E3) Glycerol-3-phosphate acyltransferase (EC 2.3.1.15) (GPAT)| Length = 886 Score = 28.5 bits (62), Expect = 9.7 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 416 PKKKTSQWGYSWSAATLVQQSFG 348 PK+K S WG WS +++Q++G Sbjct: 499 PKEKESIWGLLWSIPKVLKQNYG 521
>GP152_MOUSE (Q8BXS7) Probable G-protein coupled receptor 152| Length = 511 Score = 28.5 bits (62), Expect = 9.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -1 Query: 396 VGLFLVCCHSSSTILWLLGSKKKHSTSPRLAALVL 292 V L L+ ++ + WL GS+ +H RLA L+L Sbjct: 37 VALLLLGLPANGLMAWLAGSQARHGAGTRLALLLL 71
>CAC1S_MOUSE (Q02789) Voltage-dependent L-type calcium channel alpha-1S subunit| (Voltage-gated calcium channel alpha subunit Cav1.1) (Calcium channel, L type, alpha-1 polypeptide, isoform 3, skeletal muscle) Length = 1880 Score = 28.5 bits (62), Expect = 9.7 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -2 Query: 326 IRHHRVW---LHWSCRLVISAKFSYWCII 249 IRH R W W C ++ +K YW +I Sbjct: 411 IRHWRQWNRVFRWKCHDLVKSKVFYWLVI 439
>PLSB_XANAC (Q8PES0) Glycerol-3-phosphate acyltransferase (EC 2.3.1.15) (GPAT)| Length = 885 Score = 28.5 bits (62), Expect = 9.7 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 416 PKKKTSQWGYSWSAATLVQQSFG 348 PK+K S WG WS +++Q++G Sbjct: 499 PKEKESIWGLLWSIPKVLKQNYG 521
>GP152_HUMAN (Q8TDT2) Probable G-protein coupled receptor 152 (G-protein coupled| receptor PGR5) Length = 470 Score = 28.5 bits (62), Expect = 9.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -1 Query: 396 VGLFLVCCHSSSTILWLLGSKKKHSTSPRLAALVL 292 V L L+ ++ + WL GS+ +H RLA L+L Sbjct: 37 VALLLLGLPANGLMAWLAGSQARHGAGTRLALLLL 71 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,483,445 Number of Sequences: 219361 Number of extensions: 1099872 Number of successful extensions: 3113 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 3060 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3113 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
