| Clone Name | rbart45d04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HXKB_YEAST (P04807) Hexokinase-2 (EC 2.7.1.1) (Hexokinase-B) (He... | 31 | 1.6 | 2 | UBP26_HUMAN (Q9BXU7) Ubiquitin carboxyl-terminal hydrolase 26 (E... | 28 | 8.1 |
|---|
>HXKB_YEAST (P04807) Hexokinase-2 (EC 2.7.1.1) (Hexokinase-B) (Hexokinase PII)| Length = 485 Score = 30.8 bits (68), Expect = 1.6 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +2 Query: 71 PLNQSKKNSDVKYTWAYTYTAPSIEQSDYYPRQLRR*TKRSI 196 P +Q+K N + W + P+IE D P ++ TKR+I Sbjct: 159 PASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRNI 200
>UBP26_HUMAN (Q9BXU7) Ubiquitin carboxyl-terminal hydrolase 26 (EC 3.1.2.15)| (Ubiquitin thioesterase 26) (Ubiquitin-specific-processing protease 26) (Deubiquitinating enzyme 26) Length = 913 Score = 28.5 bits (62), Expect = 8.1 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 8/42 (19%) Frame = +2 Query: 248 TRRTMIELVYRKRDARLVLFFS--------FSDVVQNLAMKS 349 ++ IE V RK+ RLVL+F SD +QN+ +KS Sbjct: 22 SKEAFIEAVERKKKDRLVLYFKSGKYSTFRLSDNIQNVVLKS 63 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,344,489 Number of Sequences: 219361 Number of extensions: 918711 Number of successful extensions: 2206 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2170 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2200 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)