Clone Name | rbart45c11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | KPC1_CANAL (P43057) Protein kinase C-like 1 (EC 2.7.11.13) (PKC 1) | 29 | 2.8 | 2 | Y2066_MYCLE (O32912) Hypothetical protein ML2066 | 28 | 8.1 |
---|
>KPC1_CANAL (P43057) Protein kinase C-like 1 (EC 2.7.11.13) (PKC 1)| Length = 1097 Score = 29.3 bits (64), Expect = 2.8 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -3 Query: 159 IPCHYQIITQN-TTWCCYCIL*IRWEMDRVRNKVLCCIVLSH 37 IP ++ IT + T WCC+C + W VR K C V+ H Sbjct: 479 IPHRFEPITNHGTKWCCHCGYILPWGKKNVR-KCTECGVMCH 519
>Y2066_MYCLE (O32912) Hypothetical protein ML2066| Length = 478 Score = 27.7 bits (60), Expect = 8.1 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 15/47 (31%) Frame = -1 Query: 191 LQEIVSYRKSPSLVI---------------TRLLHRTPHGVAIVSYE 96 +Q+ V + KS LVI T L+H+ HGVA+V++E Sbjct: 82 VQQAVEFVKSRDLVIDTPVLLTPNDSVSDATTLIHKRAHGVAVVAFE 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,176,645 Number of Sequences: 219361 Number of extensions: 766804 Number of successful extensions: 1432 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1422 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1432 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)