Clone Name | rbart45b09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | AXN2_MOUSE (O88566) Axin-2 (Axis inhibition protein 2) (Conducti... | 36 | 0.064 | 2 | UL53_HCMVA (P16794) Protein UL53 (HFRF2 protein) | 30 | 3.5 | 3 | BAT2_MOUSE (Q7TSC1) Large proline-rich protein BAT2 (HLA-B-assoc... | 29 | 6.0 |
---|
>AXN2_MOUSE (O88566) Axin-2 (Axis inhibition protein 2) (Conductin) (Axin-like| protein) (Axil) Length = 840 Score = 35.8 bits (81), Expect = 0.064 Identities = 20/77 (25%), Positives = 32/77 (41%) Frame = +3 Query: 171 PVHSYNSTPHI*LSSNPGPLLREPGCSLLSTDVSEPPSNRPSLAHMYSHNQAKSRPLFTH 350 P SY P L + +L+ PGC P S P H + H+Q + L + Sbjct: 427 PSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHQHHHHQ-QCHTLLST 485 Query: 351 DHRVPSV*GCPVFNART 401 ++P V CP+ ++ Sbjct: 486 GGKLPPVAACPLLGGKS 502
>UL53_HCMVA (P16794) Protein UL53 (HFRF2 protein)| Length = 376 Score = 30.0 bits (66), Expect = 3.5 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Frame = +3 Query: 207 LSSNPGPLLREPGCSLLSTDVSEPPSNRP----SLAHMYSHNQAKSRPLFTHDHRVPS 368 L+++P ++ GC S+ S PP P + H YSH+Q++S+ H HR S Sbjct: 309 LTASPLHVVSTNGCGPSSSSQSTPPHLHPPSQATQPHHYSHHQSQSQ---QHHHRPQS 363
>BAT2_MOUSE (Q7TSC1) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2158 Score = 29.3 bits (64), Expect = 6.0 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 219 PGPLLREPGCSLLSTDVSEPPSNRPSLAH 305 P PL PG S ++ SEPP RP +H Sbjct: 1686 PSPLNAVPGESASGSEPSEPPRRRPPASH 1714 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,973,047 Number of Sequences: 219361 Number of extensions: 1358749 Number of successful extensions: 3105 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3039 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3104 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)