Clone Name | rbart45b07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TX3A_PHONI (P81793) Neurotoxin Pn3A precursor | 30 | 1.8 | 2 | YAS5_SCHPO (Q10141) Hypothetical protein C3H8.05c precursor | 29 | 3.1 |
---|
>TX3A_PHONI (P81793) Neurotoxin Pn3A precursor| Length = 80 Score = 29.6 bits (65), Expect = 1.8 Identities = 21/64 (32%), Positives = 27/64 (42%) Frame = -2 Query: 216 LGLAVHNLFSET*QNSSVNLKLISENGLRSANPYKLHRCPSEPCR*SCMYQCCLGIPLRL 37 L LA+ L + NS N LI E A+ YK P +PC QC LG+ + Sbjct: 10 LALALITLGIQAEPNSGPNNPLIQEEARACADVYKECWYPEKPCCKDRACQCTLGMTCKC 69 Query: 36 VVVL 25 L Sbjct: 70 KATL 73
>YAS5_SCHPO (Q10141) Hypothetical protein C3H8.05c precursor| Length = 1073 Score = 28.9 bits (63), Expect = 3.1 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 6/64 (9%) Frame = +2 Query: 68 YIQLYLQGSLGHLCNLYGFADLKPFSDMSFRFT------EEFCQVSEKRLCTANPNHVML 229 Y+ L+L + N+Y ++ + FSD S T EF S C+ P+H ++ Sbjct: 187 YVCLFLDSNSNPRINVYRWSKTETFSDASSYITFSIPVPSEFSLASHIIPCSNIPDHFLV 246 Query: 230 L*ET 241 L ET Sbjct: 247 LLET 250 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,734,740 Number of Sequences: 219361 Number of extensions: 961946 Number of successful extensions: 1488 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1466 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1487 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)