Clone Name | rbart45b01 |
---|---|
Clone Library Name | barley_pub |
>LSI1_ORYSA (Q6Z2T3) Silicon transporter LSI1 (Low silicon protein 1)| Length = 298 Score = 79.7 bits (195), Expect = 4e-15 Identities = 42/58 (72%), Positives = 52/58 (89%), Gaps = 3/58 (5%) Frame = -1 Query: 502 LGPVLGTLSGAWTYTYIRFEDPPKD-APQKLSSFKLRRLQS-QSVAADD-DELDHLPV 338 LGPV+GTLSGAWTYT+IRFED PK+ + QKLSSFKLRRL+S QS+AADD DE++++ V Sbjct: 241 LGPVMGTLSGAWTYTFIRFEDTPKEGSSQKLSSFKLRRLRSQQSIAADDVDEMENIQV 298
>NO26_SOYBN (P08995) Nodulin-26 (N-26)| Length = 271 Score = 37.4 bits (85), Expect = 0.023 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = -1 Query: 502 LGPVLGTLSGAWTYTYIRFEDPPKDAPQKLSSFKLRRLQSQ 380 L PV+G ++GAW Y +R+ D P K +SF R S+ Sbjct: 231 LAPVVGAIAGAWVYNIVRYTDKPLSETTKSASFLKGRAASK 271
>NIP41_ARATH (Q9FIZ9) Putative aquaporin NIP4.1 (NOD26-like intrinsic protein| 4.1) Length = 283 Score = 34.7 bits (78), Expect = 0.15 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = -1 Query: 502 LGPVLGTLSGAWTYTYIRFEDPPKDAPQKLSSF 404 +GPVLG +SG + Y IRF D P K +SF Sbjct: 236 VGPVLGVISGGFVYNLIRFTDKPLRELTKSASF 268
>NIP12_ARATH (Q8LFP7) Aquaporin NIP1.2 (NOD26-like intrinsic protein 1.2)| (Nodulin-26-like major intrinsic protein 2) (AtNLM2) (NLM2 protein) (NodLikeMip2) Length = 294 Score = 33.9 bits (76), Expect = 0.25 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 502 LGPVLGTLSGAWTYTYIRFEDPPKDAPQKLSSF 404 + P++G +SGAW Y +R+ D P K SF Sbjct: 252 VSPIVGAVSGAWVYNMVRYTDKPLREITKSGSF 284
>NIP11_ARATH (Q8VZW1) Aquaporin NIP1.1 (NOD26-like intrinsic protein 1.1)| (Nodulin-26-like major intrinsic protein 1) (AtNLM1) (NLM1 protein) (NodLikeMip1) Length = 296 Score = 32.7 bits (73), Expect = 0.56 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 502 LGPVLGTLSGAWTYTYIRFEDPPKDAPQKLSSF 404 + P LG ++GAW Y +R+ D P K SF Sbjct: 255 VAPTLGAIAGAWVYNTVRYTDKPLREITKSGSF 287
>NIP51_ARATH (Q9SV84) Probable aquaporin NIP5.1 (NOD26-like intrinsic protein| 5.1) (Nodulin-26-like major intrinsic protein 6) (AtNLM6) (NLM6 protein) (NodLikeMip6) Length = 304 Score = 32.0 bits (71), Expect = 0.95 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -1 Query: 502 LGPVLGTLSGAWTYTYIRFEDPPKDAPQKLSSFK 401 + P LG +SGA YT ++ D D P+ + SF+ Sbjct: 270 VAPTLGAISGAAVYTGVKLNDSVTDPPRPVRSFR 303
>NIP1_NICAL (P49173) Probable aquaporin NIP-type (Pollen-specific membrane| integral protein) Length = 270 Score = 31.6 bits (70), Expect = 1.2 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -1 Query: 502 LGPVLGTLSGAWTYTYIRFEDPP 434 +GP++GTL+GA+ Y IR D P Sbjct: 235 VGPIIGTLAGAFVYNLIRSTDKP 257
>NIP42_ARATH (Q8W036) Probable aquaporin NIP4.2 (NOD26-like intrinsic protein| 4.2) (Nodulin-26-like major intrinsic protein 5) (AtNLM5) (NLM5 protein) (NodLikeMip5) Length = 283 Score = 31.2 bits (69), Expect = 1.6 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = -1 Query: 502 LGPVLGTLSGAWTYTYIRFEDPPKDAPQKLSSFKLRRLQSQSVAADDD 359 +GP +G +G + Y ++RF D P K +SF LR + + A+ D Sbjct: 236 VGPFVGIFAGGFVYNFMRFTDKPLRELTKSASF-LRSVAQKDNASKSD 282
>VGFR1_MOUSE (P35969) Vascular endothelial growth factor receptor 1 precursor| (EC 2.7.10.1) (VEGFR-1) (Tyrosine-protein kinase receptor FLT) (FLT-1) (Embryonic receptor kinase 2) Length = 1333 Score = 30.8 bits (68), Expect = 2.1 Identities = 17/59 (28%), Positives = 26/59 (44%) Frame = +1 Query: 94 VRPPSSVVCTHEQSEREQSTATMRGRTNIHMRAREYSPACIDQPLSLQVTHTHTHNNYY 270 +RPPS V H Q+ TAT T + M A + ++ +H+HNN + Sbjct: 235 IRPPSPVRLLHGQTLVLNCTATTELNTRVQMSWNYPGKATKRASIRQRIDRSHSHNNVF 293
>CRUM2_MOUSE (Q80YA8) Crumbs homolog 2 (Crumbs-like protein 2) (Fragment)| Length = 1248 Score = 29.6 bits (65), Expect = 4.7 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Frame = -2 Query: 219 VDTCRGVLACAHVYVCSPAHCRSRLLSLALFMCAND*AWGAHECMSART-LQSHACQVYL 43 +D C+ C H CS ++A ++C AWG H+C T Q H C + Sbjct: 329 MDECQSE-PCLHGGTCSD--------TVAGYICQCPEAWGGHDCSVQLTGCQGHTCPLAA 379 Query: 42 SC 37 +C Sbjct: 380 TC 381
>NIP31_ARATH (Q9C6T0) Putative aquaporin NIP3.1 (NOD26-like intrinsic protein| 3.1) Length = 269 Score = 29.6 bits (65), Expect = 4.7 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 502 LGPVLGTLSGAWTYTYIR 449 + PV+G LSGAWTY +R Sbjct: 189 VSPVIGALSGAWTYGLLR 206
>ERFB_EMENI (Q5B3W7) Palmitoyltransferase erf2 (EC 2.3.1.-) (DHHC cysteine-rich| domain-containing protein erf2) (Ras protein acyltransferase) Length = 601 Score = 29.6 bits (65), Expect = 4.7 Identities = 13/40 (32%), Positives = 25/40 (62%) Frame = -1 Query: 460 TYIRFEDPPKDAPQKLSSFKLRRLQSQSVAADDDELDHLP 341 TY++F++ ++ Q+LS+ K R L + +D E+ H+P Sbjct: 557 TYMQFKEYYQEGDQRLSTVKRRFLPRNTEPQNDIEMQHVP 596
>ERFB_ASPFU (Q4WWN2) Palmitoyltransferase erf2 (EC 2.3.1.-) (DHHC cysteine-rich| domain-containing protein erf2) (Ras protein acyltransferase) Length = 607 Score = 29.3 bits (64), Expect = 6.2 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -1 Query: 460 TYIRFEDPPKDAPQKLSSFKLRRLQSQSVAADDDELDHLP 341 TY++F+ P ++ Q+LS+ K + A D E+ H+P Sbjct: 562 TYLQFKRPYQEGDQRLSAMKRKDRPRDVEAQADIEMQHVP 601
>ILVD_METMP (Q6M0F3) Dihydroxy-acid dehydratase (EC 4.2.1.9) (DAD)| Length = 550 Score = 28.9 bits (63), Expect = 8.1 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 210 CRGVLACAHVYVCSPAHCRSRLLSLALFMCAND*AWGAHECMSAR 76 C G +CA +Y + C + L L+L MCA A A + A+ Sbjct: 185 CSGAGSCAGLYTANSMACLTEALGLSLPMCATTHAVDAQKVRLAK 229 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,953,936 Number of Sequences: 219361 Number of extensions: 1006312 Number of successful extensions: 2974 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 2869 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2968 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)