| Clone Name | rbart44h01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GNL3_HUMAN (Q9BVP2) Guanine nucleotide-binding protein-like 3 (N... | 32 | 0.78 | 2 | GNL3_RAT (Q811S9) Guanine nucleotide-binding protein-like 3 (Nuc... | 31 | 2.3 | 3 | GNL3_MOUSE (Q8CI11) Guanine nucleotide-binding protein-like 3 (N... | 30 | 3.0 | 4 | GP158_MOUSE (Q8C419) Probable G-protein coupled receptor 158 pre... | 29 | 6.6 |
|---|
>GNL3_HUMAN (Q9BVP2) Guanine nucleotide-binding protein-like 3 (Nucleolar| GTP-binding protein 3) (Nucleostemin) (E2-induced gene 3-protein) (Novel nucleolar protein 47) (NNP47) Length = 549 Score = 32.3 bits (72), Expect = 0.78 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 4/56 (7%) Frame = -3 Query: 419 KEKDGHRANKRESLRMGHRGNSRIP----SAHESREKLRNSDIFKKRLDEPDEQQK 264 K ++ HR ++E+ + GH+ + P SA LR +++ K+RL+E +QQK Sbjct: 24 KVREHHRKLRKEAKKQGHKKPRKDPGVPNSAPFKEALLREAELRKQRLEELKQQQK 79
>GNL3_RAT (Q811S9) Guanine nucleotide-binding protein-like 3 (Nucleolar| GTP-binding protein 3) (Nucleostemin) Length = 538 Score = 30.8 bits (68), Expect = 2.3 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 4/56 (7%) Frame = -3 Query: 419 KEKDGHRANKRESLRMGHRGNSRIP----SAHESREKLRNSDIFKKRLDEPDEQQK 264 K ++ HR ++E+ + GH+ + P SA LR +++ K++L+E +QQK Sbjct: 24 KVREHHRKLRKEAKKRGHKKPKKDPGVPNSAPFKEALLREAELRKQQLEELKQQQK 79
>GNL3_MOUSE (Q8CI11) Guanine nucleotide-binding protein-like 3 (Nucleolar| GTP-binding protein 3) (Nucleostemin) Length = 538 Score = 30.4 bits (67), Expect = 3.0 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 4/56 (7%) Frame = -3 Query: 419 KEKDGHRANKRESLRMGHRGNSRIP----SAHESREKLRNSDIFKKRLDEPDEQQK 264 K ++ HR ++E+ + GH+ + P SA LR +++ K++L+E +QQK Sbjct: 24 KVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLREAELRKQQLEELKQQQK 79
>GP158_MOUSE (Q8C419) Probable G-protein coupled receptor 158 precursor| Length = 1200 Score = 29.3 bits (64), Expect = 6.6 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 5/69 (7%) Frame = -3 Query: 455 QKAQSLIFPSAMKEKDGHRANKRESLRMGHRGNSRIPSAHESREKLRNSDIFKK-----R 291 QK+ S+I ++ KEK A K ++L M R S+ P E+ K NSD + Sbjct: 900 QKSLSVI--ASAKEKTLGLAGKTQTLVMEDRAKSQKPKDRETIRKYSNSDNVETIPNSGH 957 Query: 290 LDEPDEQQK 264 ++EP + QK Sbjct: 958 MEEPRKPQK 966 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,900,125 Number of Sequences: 219361 Number of extensions: 1433214 Number of successful extensions: 3501 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3339 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3501 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3812186532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)