| Clone Name | rbart44g11 |
|---|---|
| Clone Library Name | barley_pub |
>SCW10_YEAST (Q04951) Probable family 17 glucosidase SCW10 precursor (EC| 3.2.1.-) (Soluble cell wall protein 10) Length = 389 Score = 30.0 bits (66), Expect = 2.3 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = -3 Query: 297 AWTVTLGKPISTTKANIKSSGVVQYLVFVRPCVS*INTPDNCS 169 A T +G+ +ST K+ + S+G +V V ++ IN PD C+ Sbjct: 237 ATTTQVGEYVSTAKSALTSAGYTGSVVSVDTFIAVINNPDLCN 279
>DYI2_CHLRE (Q39578) Dynein, 78 kDa intermediate chain, flagellar outer arm| (IC78) Length = 682 Score = 29.3 bits (64), Expect = 3.9 Identities = 15/63 (23%), Positives = 34/63 (53%) Frame = -1 Query: 368 SQQHKSQSNSILTMWINKRSNRVVHGLLRWANPYRQPKQTSSPAESCSIWSLYDPVFRES 189 S+Q ++Q N ++R+ + ++ LR + +P T++ + +C+ W +YD ++ Sbjct: 159 SRQLRNQFN------FSERAAQTLNYPLRDRETFTEPPPTATVSGACTQWEIYDEYIKDL 212 Query: 188 TRQ 180 RQ Sbjct: 213 ERQ 215
>CAN1_MACFA (Q9GLG2) Calpain-1 catalytic subunit (EC 3.4.22.52) (Calpain-1| large subunit) (Calcium-activated neutral proteinase 1) (CANP 1) (Calpain mu-type) (muCANP) (Micromolar-calpain) Length = 714 Score = 29.3 bits (64), Expect = 3.9 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = -1 Query: 323 INKRSNRVVHGLLRWANPYRQPKQTSSPAESCSIWSLYDPVFRESTR 183 +N R V L+R NP+ + + T + ++S S W+ DP RE R Sbjct: 282 VNYRGQMV--NLIRMRNPWGEVEWTGAWSDSSSEWNSVDPYEREQLR 326
>CAN1_BOVIN (Q27970) Calpain-1 catalytic subunit (EC 3.4.22.52) (Calpain-1| large subunit) (Calcium-activated neutral proteinase 1) (CANP 1) (Calpain mu-type) (muCANP) (Micromolar-calpain) Length = 716 Score = 28.5 bits (62), Expect = 6.7 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -1 Query: 290 LLRWANPYRQPKQTSSPAESCSIWSLYDPVFRESTR 183 L+R NP+ + + T + ++ S W+ DP RE R Sbjct: 291 LIRMRNPWGEVEWTGAWSDGSSEWNAVDPYMREQLR 326
>TOR1_YEAST (P35169) Phosphatidylinositol 3-kinase TOR1 (EC 2.7.1.137)| (PtdIns-3-kinase TOR1) (PI3-kinase TOR1) (PI3K TOR1) Length = 2470 Score = 28.1 bits (61), Expect = 8.8 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 3/63 (4%) Frame = -1 Query: 359 HKSQSNSILTMW---INKRSNRVVHGLLRWANPYRQPKQTSSPAESCSIWSLYDPVFRES 189 HK N T+ K R ++ W N Y++ K ++ ++ W +Y VFR+ Sbjct: 1992 HKHLGNEPQTLSEVSFQKSFGRDLNDAYEWLNNYKKSKDINNLNQA---WDIYYNVFRKI 2048 Query: 188 TRQ 180 TRQ Sbjct: 2049 TRQ 2051 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,485,687 Number of Sequences: 219361 Number of extensions: 1173302 Number of successful extensions: 2504 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2504 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)