Clone Name | rbart44e06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UL52_EBV (P03193) Helicase/primase complex protein (Probable DNA... | 31 | 1.7 | 2 | RECK_HUMAN (O95980) Reversion-inducing cysteine-rich protein wit... | 28 | 8.6 |
---|
>UL52_EBV (P03193) Helicase/primase complex protein (Probable DNA replication| protein BSLF1) Length = 874 Score = 30.8 bits (68), Expect = 1.7 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -3 Query: 207 SKHVRTYVRRRTALAMHITHANVRTRMEHLLFFRWIGSP 91 ++H+RTY R T LA H+ ++ RME + W P Sbjct: 312 AEHMRTYFTRETYLAEHVRVQQLKIRMEPPAPYTWDPDP 350
>RECK_HUMAN (O95980) Reversion-inducing cysteine-rich protein with Kazal motifs| precursor (hRECK) (Suppressor of tumorigenicity 15) (ST15) Length = 971 Score = 28.5 bits (62), Expect = 8.6 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 7/60 (11%) Frame = -1 Query: 260 LSYCEFVVALPCRGSCTKVST-------YVRTYDDALHLPCISRMQTYVHAWNICYSFDG 102 L CE +AL CR +C + S+ + Y++AL CISR + ++C S+ G Sbjct: 102 LGCCELAIALECRQACKQASSKNDISKVCRKEYENAL-FSCISRNE----MGSVCCSYAG 156 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,627,133 Number of Sequences: 219361 Number of extensions: 1006376 Number of successful extensions: 2595 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2589 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)