Clone Name | rbart44e03 |
---|---|
Clone Library Name | barley_pub |
>USP9Y_HUMAN (O00507) Probable ubiquitin carboxyl-terminal hydrolase FAF-Y (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-Y) (Ubiquitin-specific-processing protease FAF-Y) (Deubiquitinating enzyme FAF-Y) (Fat facets protein-related, Y-linked) (Ubiquitin-specif Length = 2555 Score = 30.0 bits (66), Expect = 3.3 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 152 ASFTYIALDNSPSPPIKSKSATLTRLLSLL 241 A+F ++LD P PPIK + A L +L S++ Sbjct: 2204 ATFMLVSLDEGPGPPIKYQYAELGKLYSVV 2233
>USP9X_MOUSE (P70398) Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-X) (Ubiquitin-specific-processing protease FAF-X) (Deubiquitinating enzyme FAF-X) (Fat facets protein-related, X-linked) (Ubiquitin-specif Length = 2559 Score = 30.0 bits (66), Expect = 3.3 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 152 ASFTYIALDNSPSPPIKSKSATLTRLLSLL 241 A+F ++LD P PPIK + A L +L S++ Sbjct: 2203 ATFMLVSLDEGPGPPIKYQYAELGKLYSVV 2232
>USP9X_HUMAN (Q93008) Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-X) (Ubiquitin specific-processing protease FAF-X) (Deubiquitinating enzyme FAF-X) (Fat facets protein related, X-linked) (Ubiquitin-specif Length = 2547 Score = 30.0 bits (66), Expect = 3.3 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 152 ASFTYIALDNSPSPPIKSKSATLTRLLSLL 241 A+F ++LD P PPIK + A L +L S++ Sbjct: 2196 ATFMLVSLDEGPGPPIKYQYAELGKLYSVV 2225
>MARK3_RAT (Q8VHF0) MAP/microtubule affinity-regulating kinase 3 (EC 2.7.11.1)| Length = 797 Score = 28.9 bits (63), Expect = 7.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 166 HRTGQQSVSSHQKQECYTDKA 228 H GQ+SVSS QKQ Y+D A Sbjct: 402 HHKGQRSVSSSQKQRRYSDHA 422
>MARK3_MOUSE (Q03141) MAP/microtubule affinity-regulating kinase 3 (EC 2.7.11.1)| (MPK-10) (ELKL motif kinase 2) Length = 753 Score = 28.9 bits (63), Expect = 7.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 166 HRTGQQSVSSHQKQECYTDKA 228 H GQ+SVSS QKQ Y+D A Sbjct: 402 HHKGQRSVSSSQKQRRYSDHA 422
>DRL43_ARATH (Q9FKZ0) Probable disease resistance protein At5g66910| Length = 815 Score = 28.5 bits (62), Expect = 9.6 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 173 LDNSPSPPIKSKSATLTRLLSLLKVNLQW 259 L SP+PP+ SK ++ +L +++ V L W Sbjct: 149 LSGSPAPPLVSKRCSVPKLDNMVLVGLDW 177 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,825,816 Number of Sequences: 219361 Number of extensions: 633250 Number of successful extensions: 1295 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1278 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1295 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)