Clone Name | rbart44d04 |
---|---|
Clone Library Name | barley_pub |
>LAS17_YEAST (Q12446) Proline-rich protein LAS17| Length = 633 Score = 33.1 bits (74), Expect = 0.19 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = +1 Query: 97 HTPRRDGKFENY---YRGRGRNTIHVRAHQQPPPPPHDRSTMNSDKIPSMA 240 H PR + +N Y +TI H+ PPPPP T +SD+ S + Sbjct: 154 HGPRGESLIDNQRKRYNYEDVDTIPTTKHKAPPPPPPTAETFDSDQTSSFS 204
>INADL_MOUSE (Q63ZW7) InaD-like protein (Inadl protein) (Pals1-associated tight| junction protein) (Protein associated to tight junctions) (Channel-interacting PDZ domain-containing protein) Length = 1834 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 160 HVRAHQQPPPPPHDRSTMNSDKIPSMAAQTDW 255 H+RA + PPPPH R + + + A T W Sbjct: 882 HLRAMESNPPPPHIREAAPASPVLELQAGTQW 913
>NONO_PONPY (Q5RFL9) Non-POU domain-containing octamer-binding protein (NonO| protein) Length = 471 Score = 29.3 bits (64), Expect = 2.8 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 88 RQAHTPRRDGKFENYYRGRGRNTIHVRAHQQPPPPP 195 +Q HTPR+ +++ + H + QQPPPPP Sbjct: 11 KQNHTPRK------HHQHHHQQQHHQQQQQQPPPPP 40
>NONO_HUMAN (Q15233) Non-POU domain-containing octamer-binding protein (NonO| protein) (54 kDa nuclear RNA- and DNA-binding protein) (p54(nrb)) (p54nrb) (55 kDa nuclear protein) (NMT55) (DNA-binding p52/p100 complex, 52 kDa subunit) Length = 471 Score = 29.3 bits (64), Expect = 2.8 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 88 RQAHTPRRDGKFENYYRGRGRNTIHVRAHQQPPPPP 195 +Q HTPR+ +++ + H + QQPPPPP Sbjct: 11 KQNHTPRK------HHQHHHQQQHHQQQQQQPPPPP 40
>CAC1A_RABIT (P27884) Voltage-dependent P/Q-type calcium channel alpha-1A subunit| (Voltage-gated calcium channel alpha subunit Cav2.1) (Calcium channel, L type, alpha-1 polypeptide isoform 4) (Brain calcium channel I) (BI) Length = 2424 Score = 29.3 bits (64), Expect = 2.8 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = +1 Query: 76 RGRCRQAHTPRR--DGKFENYYRGRGRNTIHVRAHQQPPPPPHDRSTMNSDK 225 RGR R+ P R +G+ E G G R H+ PPP +D D+ Sbjct: 982 RGRHREGSRPARSGEGEAEGPDGGGGGGGERRRRHRHGPPPAYDPDARRDDR 1033
>AF9_USTMA (Q4PFI5) Protein AF-9 homolog| Length = 431 Score = 29.3 bits (64), Expect = 2.8 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 113 TANLKTITGGAAETRSTYARTSNHHHHHMIGRR 211 T + + GG+A T ST R H +H M+G + Sbjct: 84 TPSSSSAAGGSAATVSTRGRDQEHDYHKMVGNK 116
>V120_EBV (P03189) Capsid assembly protein BOLF1| Length = 1239 Score = 29.3 bits (64), Expect = 2.8 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +1 Query: 139 GRGRNTIHVRAHQQPPPPPHDRSTMNSDKIPSMAAQTDWS 258 G GRN RA + PPPH R D P + +D+S Sbjct: 1088 GNGRNASKRRASRDLSPPPHGRWRAVLDSSPFSFSSSDFS 1127
>CHD8_HUMAN (Q9HCK8) Chromodomain-helicase-DNA-binding protein 8 (EC 3.6.1.-)| (ATP-dependent helicase CHD8) (CHD-8) (Helicase with SNF2 domain 1) Length = 2302 Score = 25.0 bits (53), Expect(2) = 4.3 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 131 ITGGAAETRSTYARTSNHHHHH 196 + GGA + + T HHHHH Sbjct: 2197 VMGGAPSSPHVDSSTMLHHHHH 2218 Score = 21.9 bits (45), Expect(2) = 4.3 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 179 NHHHHHMIGRR 211 +HHHHH G R Sbjct: 2223 HHHHHHHPGLR 2233
>NDUA3_BOVIN (Q02371) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit| 3 (EC 1.6.5.3) (EC 1.6.99.3) (NADH-ubiquinone oxidoreductase B9 subunit) (Complex I-B9) (CI-B9) Length = 83 Score = 28.5 bits (62), Expect = 4.7 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 174 VRAYVDRVSAAPPVIVFKFAVSPRCVCLPAASP 76 V A++ V A PV+V FA++ V LP SP Sbjct: 4 VAAFLKNVWAKEPVLVASFAIAGLAVILPTLSP 36
>DLGP3_RAT (P97838) Disks large-associated protein 3 (DAP-3)| (SAP90/PSD-95-associated protein 3) (SAPAP3) (PSD-95/SAP90-binding protein 3) Length = 977 Score = 28.1 bits (61), Expect = 6.2 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +2 Query: 80 DAAGRHTHRGETANLKTITGGAAETR--STYARTSNHHHHH 196 +A G+ + G A ++ +GG + + S TS+HHHHH Sbjct: 187 EAPGKRDYNGPKAEGRSSSGGDSYSGPGSGGPPTSHHHHHH 227
>ZCH14_HUMAN (Q8WYQ9) Zinc finger CCHC domain-containing protein 14 (BDG-29)| Length = 949 Score = 28.1 bits (61), Expect = 6.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 134 TGGAAETRSTYARTSNHHHHH 196 +GG T + A NHHHHH Sbjct: 747 SGGGGSTGNIPASNPNHHHHH 767
>NO75_LUPLU (Q06841) Early nodulin 75 protein (N-75) (NGM-75) (Fragment)| Length = 434 Score = 28.1 bits (61), Expect = 6.2 Identities = 10/23 (43%), Positives = 17/23 (73%), Gaps = 3/23 (13%) Frame = +1 Query: 157 IHVRAHQQPP---PPPHDRSTMN 216 +H +H++PP PPPH++S M+ Sbjct: 267 VHPPSHEKPPFVYPPPHEKSPMH 289
>AGLU_SPIOL (O04893) Alpha-glucosidase precursor (EC 3.2.1.20) (Maltase)| Length = 903 Score = 28.1 bits (61), Expect = 6.2 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 151 NTIHVRAHQQPPPPPHDRSTM 213 N +H HQ PPPPPH S++ Sbjct: 104 NILH--RHQPPPPPPHSLSSL 122
>BRD4_HUMAN (O60885) Bromodomain-containing protein 4 (HUNK1 protein)| Length = 1362 Score = 23.9 bits (50), Expect(2) = 7.3 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +1 Query: 103 PRRDGKFENYYRGRGRNTIHVRAHQQPPPPP 195 P R+ K +++ + QQPPPPP Sbjct: 731 PGREQKKHHHHHHQQMQQAPAPVPQQPPPPP 761 Score = 22.3 bits (46), Expect(2) = 7.3 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +1 Query: 175 QQPPPPPHDRSTMNSDKIPSM 237 QQ PPPP +M P+M Sbjct: 773 QQQPPPPPPPPSMPQQAAPAM 793
>DLGP3_MOUSE (Q6PFD5) Disks large-associated protein 3 (DAP-3)| (SAP90/PSD-95-associated protein 3) (SAPAP3) (PSD-95/SAP90-binding protein 3) Length = 977 Score = 27.7 bits (60), Expect = 8.1 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +2 Query: 80 DAAGRHTHRGETANLKTITGGAAETR--STYARTSNHHHHH 196 +A G+ + G A+ + +GG + + S TS+HHHHH Sbjct: 187 EAPGKRDYNGPKADGRGSSGGDSYSGPGSGGTPTSHHHHHH 227
>MDN1_YEAST (Q12019) Midasin (MIDAS-containing protein)| Length = 4910 Score = 27.7 bits (60), Expect = 8.1 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Frame = +1 Query: 16 QKGGKVVQQVLY*LKLANLNRGRCRQAHTPRRDG----KFENYYRGRGRNTIHVRAH 174 QK +++ V+ L L + + TP G +F++Y+ +G NTI +AH Sbjct: 998 QKSEAILKPVIEKFTLGRLKNVKSIMSQTPPSPGPDYVQFKHYWMKKGPNTIQEQAH 1054
>KP58_DROME (Q9VPC0) Serine/threonine-protein kinase PITSLRE (EC 2.7.11.22)| (Cell division cycle 2-like) Length = 952 Score = 27.7 bits (60), Expect = 8.1 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 161 TYARTSNHHHHHMIGRR*TAIKFHPWP 241 +YA HHH H+ G R ++H +P Sbjct: 135 SYAAHHYHHHQHLSGARAAPREYHSYP 161
>CD2L7_CAEEL (P46551) Putative cell division cycle 2-related protein kinase 7| (EC 2.7.11.22) Length = 730 Score = 24.3 bits (51), Expect(2) = 9.8 Identities = 10/40 (25%), Positives = 16/40 (40%) Frame = +2 Query: 77 GDAAGRHTHRGETANLKTITGGAAETRSTYARTSNHHHHH 196 G + H+ R + T+S + +HHHHH Sbjct: 644 GSSGSGHSIRATSHPRAPTQPSTTTTKSNGSSNHHHHHHH 683 Score = 21.6 bits (44), Expect(2) = 9.8 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +1 Query: 172 HQQPPPPPHDRSTMNS 219 H PPPPP +++ S Sbjct: 697 HAPPPPPPPTQASSTS 712 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,281,083 Number of Sequences: 219361 Number of extensions: 812828 Number of successful extensions: 4723 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 3488 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4224 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)