| Clone Name | rbart44c11 |
|---|---|
| Clone Library Name | barley_pub |
>DCE1_ARATH (Q42521) Glutamate decarboxylase 1 (EC 4.1.1.15) (GAD 1)| Length = 502 Score = 40.8 bits (94), Expect = 0.001 Identities = 15/31 (48%), Positives = 24/31 (77%) Frame = -2 Query: 374 TVSEKDLARQREVVSVWKRAVAARKKTQGVC 282 TV + D+ +QR++++ WK+ VA RKKT G+C Sbjct: 472 TVKKSDIDKQRDIITGWKKFVADRKKTSGIC 502
>CCHCR_GORGO (Q8HZ59) Coiled-coil alpha-helical rod protein 1 (Alpha helical| coiled-coil rod protein) Length = 782 Score = 30.8 bits (68), Expect = 1.4 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = -2 Query: 401 PSLQHPNGDTVSEKDLARQREVVSVWKRAVAARKKTQG 288 P +Q P VSE+ L QR V++W+R V++ ++ G Sbjct: 36 PLVQPPGHQDVSERQLDTQRPQVTMWERDVSSDRQEPG 73
>CCHCR_PONPY (Q8HZ58) Coiled-coil alpha-helical rod protein 1 (Alpha helical| coiled-coil rod protein) Length = 782 Score = 30.0 bits (66), Expect = 2.3 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = -2 Query: 401 PSLQHPNGDTVSEKDLARQREVVSVWKRAVAARKKTQG 288 P +Q P VSE+ L QR V++W+R V++ ++ G Sbjct: 36 PLVQPPGHQDVSERRLDTQRPQVTMWERDVSSDRQEPG 73
>CCHCR_PANTR (Q8HZ60) Coiled-coil alpha-helical rod protein 1 (Alpha helical| coiled-coil rod protein) Length = 782 Score = 30.0 bits (66), Expect = 2.3 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = -2 Query: 401 PSLQHPNGDTVSEKDLARQREVVSVWKRAVAARKKTQG 288 P +Q P VSE+ L QR V++W+R V++ ++ G Sbjct: 36 PLVQPPGHQDVSERRLDTQRPQVTMWERDVSSDRQEPG 73
>CCHCR_PANPA (Q8HZ57) Coiled-coil alpha-helical rod protein 1 (Alpha helical| coiled-coil rod protein) Length = 782 Score = 30.0 bits (66), Expect = 2.3 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = -2 Query: 401 PSLQHPNGDTVSEKDLARQREVVSVWKRAVAARKKTQG 288 P +Q P VSE+ L QR V++W+R V++ ++ G Sbjct: 36 PLVQPPGHQDVSERRLDTQRPQVTMWERDVSSDRQEPG 73
>CCHCR_HUMAN (Q8TD31) Coiled-coil alpha-helical rod protein 1 (Alpha helical| coiled-coil rod protein) (Putative gene 8 protein) (Pg8) Length = 782 Score = 30.0 bits (66), Expect = 2.3 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = -2 Query: 401 PSLQHPNGDTVSEKDLARQREVVSVWKRAVAARKKTQG 288 P +Q P VSE+ L QR V++W+R V++ ++ G Sbjct: 36 PLVQPPGHQDVSERRLDTQRPQVTMWERDVSSDRQEPG 73
>BLNK_HUMAN (Q8WV28) B-cell linker protein (Cytoplasmic adapter protein)| (B-cell adapter containing SH2 domain protein) (B-cell adapter containing Src homology 2 domain protein) (Src homology 2 domain-containing leukocyte protein of 65 kDa) (SLP-65) Length = 456 Score = 30.0 bits (66), Expect = 2.3 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 Query: 142 GSNNGARRTINPAP*KPSRTREA*HKIITEIKSSRTAGEVNRLSSAQQTP 291 G N+GA T +P P PS A K T +K++ A + N S ++ P Sbjct: 226 GRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKP 275
>DCE2_ARATH (Q42472) Glutamate decarboxylase 2 (EC 4.1.1.15) (GAD 2)| Length = 494 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = -2 Query: 377 DTVSEKDLARQ--REVVSVWKRAVAARKKTQGVC 282 + V EK + ++ EV+ W++ V RKK GVC Sbjct: 461 ENVKEKKMEKEILMEVIVGWRKFVKERKKMNGVC 494 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,741,452 Number of Sequences: 219361 Number of extensions: 816555 Number of successful extensions: 1767 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1767 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)