Clone Name | rbart44b09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | OCS1_MAIZE (P24068) Ocs element-binding factor 1 (OCSBF-1) | 65 | 1e-10 | 2 | K1199_MOUSE (Q8BI06) Protein KIAA1199 homolog precursor (Protein... | 29 | 5.8 | 3 | MTAA_SYNP2 (P34882) Modification methylase AquI alpha subunit (E... | 28 | 9.9 |
---|
>OCS1_MAIZE (P24068) Ocs element-binding factor 1 (OCSBF-1)| Length = 151 Score = 64.7 bits (156), Expect = 1e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 436 VNQVLRVVEEFSGVAMDIQEECPPDDPLLRPWQI 335 VN+VLR+VEEFSGVAMDIQEE P DDPLLRPWQ+ Sbjct: 101 VNEVLRLVEEFSGVAMDIQEEMPADDPLLRPWQL 134
>K1199_MOUSE (Q8BI06) Protein KIAA1199 homolog precursor (Protein 12H19.01.T7)| Length = 1361 Score = 28.9 bits (63), Expect = 5.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -3 Query: 418 VVEEFSGVAMDIQEECPPDDPLLRPW 341 ++ FSG + + ECP P L+PW Sbjct: 21 LLANFSGASSAVATECPDQSPELQPW 46
>MTAA_SYNP2 (P34882) Modification methylase AquI alpha subunit (EC 2.1.1.37)| (Cytosine-specific methyltransferase AquI alpha subunit) (M.AquI alpha subunit) (M.AquiA) Length = 248 Score = 28.1 bits (61), Expect = 9.9 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -2 Query: 275 IHPVMIGSIIQDPPCRS*AVAGKR 204 ++P+ I +I PPC+S ++AGKR Sbjct: 68 VNPLEIDLVIGGPPCQSFSLAGKR 91 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,471,423 Number of Sequences: 219361 Number of extensions: 592112 Number of successful extensions: 1492 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1491 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)