Clone Name | rbart44b01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CO4A1_CAEEL (P17139) Collagen alpha-1(IV) chain precursor | 30 | 1.8 | 2 | SYNJ1_MOUSE (Q8CHC4) Synaptojanin-1 (EC 3.1.3.36) (Synaptic inos... | 30 | 2.3 | 3 | SYNJ1_RAT (Q62910) Synaptojanin-1 (EC 3.1.3.36) (Synaptic inosit... | 30 | 3.0 |
---|
>CO4A1_CAEEL (P17139) Collagen alpha-1(IV) chain precursor| Length = 1759 Score = 30.4 bits (67), Expect = 1.8 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = -1 Query: 419 PGAEGAELDPGPQGRPEAMVGSSGTGIGAMWGRCSVRT 306 PG +GA+ DPGP G P G+ + GR VRT Sbjct: 191 PGLKGAKGDPGPYGLP------GFPGVSGLKGRMGVRT 222
>SYNJ1_MOUSE (Q8CHC4) Synaptojanin-1 (EC 3.1.3.36) (Synaptic| inositol-1,4,5-trisphosphate 5-phosphatase 1) Length = 1574 Score = 30.0 bits (66), Expect = 2.3 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +1 Query: 247 TFDDSNGLHGWAYSSVLSHLVLTEHRPHMAPMPVPLLP 360 +FDD W+ + +S VL RP P PVPLLP Sbjct: 1516 SFDDD-----WSKGASVSFCVLPARRPPPPPPPVPLLP 1548
>SYNJ1_RAT (Q62910) Synaptojanin-1 (EC 3.1.3.36) (Synaptic| inositol-1,4,5-trisphosphate 5-phosphatase 1) Length = 1574 Score = 29.6 bits (65), Expect = 3.0 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +1 Query: 247 TFDDSNGLHGWAYSSVLSHLVLTEHRPHMAPMPVPLLP 360 +FDD W+ + +S VL RP P PVPLLP Sbjct: 1516 SFDDD-----WSKGTNVSFCVLPARRPPPPPPPVPLLP 1548 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,675,618 Number of Sequences: 219361 Number of extensions: 1059810 Number of successful extensions: 3854 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2813 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3828 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)