| Clone Name | rbart43h12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SPOP_MOUSE (Q6ZWS8) Speckle-type POZ protein (PDX-1 C-terminal-i... | 39 | 0.003 | 2 | SPOP_HUMAN (O43791) Speckle-type POZ protein | 39 | 0.003 | 3 | LONM_CAEEL (O44952) Lon protease homolog, mitochondrial precurso... | 31 | 0.93 | 4 | CFC1_HUMAN (Q9GZR3) Cryptic protein precursor | 29 | 3.5 | 5 | INO80_NEUCR (Q872I5) Putative DNA helicase ino-80 (EC 3.6.1.-) | 28 | 6.0 |
|---|
>SPOP_MOUSE (Q6ZWS8) Speckle-type POZ protein (PDX-1 C-terminal-interacting| factor 1) (PCIF1) Length = 374 Score = 39.3 bits (90), Expect = 0.003 Identities = 24/75 (32%), Positives = 40/75 (53%) Frame = -3 Query: 281 INVDTAATALALAEQHNCPELKARCVDFIIRTSATLDDVLATEGFKHLEASCPLVVIDLL 102 ++V+ AA L LA+ H+ +LK + VDFI + DVL T G+K + S P +V + Sbjct: 297 LSVENAAEILILADLHSADQLKTQAVDFI---NYHASDVLETSGWKSMVVSHPHLVAEAY 353 Query: 101 KTARGRKT*GVAGPR 57 ++ + + PR Sbjct: 354 RSLASAQCPFLGPPR 368
>SPOP_HUMAN (O43791) Speckle-type POZ protein| Length = 374 Score = 39.3 bits (90), Expect = 0.003 Identities = 24/75 (32%), Positives = 40/75 (53%) Frame = -3 Query: 281 INVDTAATALALAEQHNCPELKARCVDFIIRTSATLDDVLATEGFKHLEASCPLVVIDLL 102 ++V+ AA L LA+ H+ +LK + VDFI + DVL T G+K + S P +V + Sbjct: 297 LSVENAAEILILADLHSADQLKTQAVDFI---NYHASDVLETSGWKSMVVSHPHLVAEAY 353 Query: 101 KTARGRKT*GVAGPR 57 ++ + + PR Sbjct: 354 RSLASAQCPFLGPPR 368
>LONM_CAEEL (O44952) Lon protease homolog, mitochondrial precursor (EC| 3.4.21.-) Length = 971 Score = 30.8 bits (68), Expect = 0.93 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +1 Query: 94 AVLRRSITTSGQLASRCLKPSVANTSSRVAEVLIMKSTHLAFSSGQ 231 AVL R T + LA+ S A S R +L+MKS LA +SG+ Sbjct: 6 AVLLRGATRTRLLAAASAHQSFATFSQRNQSILMMKSMELAGNSGE 51
>CFC1_HUMAN (Q9GZR3) Cryptic protein precursor| Length = 223 Score = 28.9 bits (63), Expect = 3.5 Identities = 18/52 (34%), Positives = 22/52 (42%) Frame = +1 Query: 22 DFKQIQYHGPSNLGPATPQVFLPRAVLRRSITTSGQLASRCLKPSVANTSSR 177 DF HGPS G + + LP A+L R + R L PSV R Sbjct: 161 DFLASHAHGPSAGGAPSLLLLLPCALLHRLLRPDAPAHPRSLVPSVLQRERR 212
>INO80_NEUCR (Q872I5) Putative DNA helicase ino-80 (EC 3.6.1.-)| Length = 2001 Score = 28.1 bits (61), Expect = 6.0 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +2 Query: 116 PPVGSLPRGV*NPPSPTHHQEWQRF***NQHTSPLAPGSCAARLKPKLSL 265 PP G PR + NPP+P+ + Q + H +P S + P SL Sbjct: 162 PPTG--PRSILNPPTPSQQHQQQ-----HHHPNPFVAASAPSLPPPPSSL 204 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,526,273 Number of Sequences: 219361 Number of extensions: 837460 Number of successful extensions: 2032 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1945 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2032 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)