ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart43h09 |
|---|---|
| Clone Library Name | barley_pub |
>TYDC1_ARATH (Q8RY79) Tyrosine decarboxylase 1 (EC 4.1.1.25)| Length = 490 Score = 30.8 bits (68), Expect = 0.90 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -2 Query: 308 EHHVADAWKVVQDRASVILRK 246 E HV +AWK++Q+ AS +L K Sbjct: 470 EKHVKEAWKIIQEEASYLLHK 490
>Y3408_METJA (Q60307) Hypothetical protein MJECS08| Length = 1064 Score = 29.3 bits (64), Expect = 2.6 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +2 Query: 5 RSFISLVPYFLLKTHINIKYRSSFQKKKKELQILGVPTLLRARLLDYGQVCWGKY 169 RS + PY ++ + Y FQ K E+ I+G+ T LR+R + WG++ Sbjct: 357 RSLLLNEPYEAIEMIYKVYYEKYFQFKPLEINIIGLET-LRSRTIMTKAKDWGEF 410
>PTN23_MOUSE (Q6PB44) Tyrosine-protein phosphatase non-receptor type 23 (EC| 3.1.3.48) Length = 1692 Score = 28.9 bits (63), Expect = 3.4 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 242 PFSGGLPKPDPGPPSMH 292 P SG LP P PGPP H Sbjct: 1086 PHSGALPFPSPGPPHPH 1102
>IF3_MYCPU (Q98QV2) Translation initiation factor IF-3| Length = 199 Score = 28.9 bits (63), Expect = 3.4 Identities = 19/57 (33%), Positives = 29/57 (50%) Frame = +2 Query: 83 KKKELQILGVPTLLRARLLDYGQVCWGKYALHGRETYIYSPRSNINQARCR*FPFSG 253 +KK+L ++ V AR+LDYG+ KY +E ++NIN + R P G Sbjct: 52 EKKDLVLISVQPKPIARILDYGKF---KYDRKKKEKEQKEKQTNINNRQIRLTPLIG 105
>PTN23_RAT (O88902) Tyrosine-protein phosphatase non-receptor type 23 (EC| 3.1.3.48) (His-domain-containing protein tyrosine phosphatase) (HD-PTP) (Protein tyrosine phosphatase TD14) (PTP-TD14) (Fragment) Length = 1499 Score = 28.9 bits (63), Expect = 3.4 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 242 PFSGGLPKPDPGPPSMH 292 P SG LP P PGPP H Sbjct: 893 PHSGALPFPSPGPPHPH 909
>LYTB_STRPN (P59205) Putative endo-beta-N-acetylglucosaminidase precursor (EC| 3.2.1.96) (Murein hydrolase) Length = 658 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 249 ENGNYLQRAWLMFERGEYIYV 187 ENGNY + W+ FE G Y Y+ Sbjct: 202 ENGNYADKEWI-FENGHYYYL 221
>SYH_GEOKA (Q5KWS8) Histidyl-tRNA synthetase (EC 6.1.1.21) (Histidine--tRNA| ligase) (HisRS) Length = 426 Score = 28.5 bits (62), Expect = 4.5 Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 3/36 (8%) Frame = +2 Query: 47 HINIKYRSSFQKKKKELQILGVPTLLRARL---LDY 145 ++N + R+ F+K K+ L LG+P ++ ARL LDY Sbjct: 227 YLNDESRAYFEKVKQYLTALGIPFVIDARLVRGLDY 262
>TYDC3_PAPSO (P54770) Tyrosine/DOPA decarboxylase 3 [Includes: DOPA| decarboxylase (EC 4.1.1.28) (DDC); Tyrosine decarboxylase (EC 4.1.1.25)] Length = 533 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -2 Query: 308 EHHVADAWKVVQDRASVILRKME 240 E HV AW+V+Q+ A +IL K + Sbjct: 505 ERHVIHAWEVLQEHADLILSKFD 527
>LYTB_STRR6 (P59206) Putative endo-beta-N-acetylglucosaminidase precursor (EC| 3.2.1.96) (Murein hydrolase) Length = 702 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 249 ENGNYLQRAWLMFERGEYIYV 187 ENGNY + W+ FE G Y Y+ Sbjct: 202 ENGNYADKEWI-FENGHYYYL 221
>ADDB_BACSU (P23477) ATP-dependent nuclease subunit B (EC 3.6.1.-)| (ATP-dependent helicase addB) Length = 1166 Score = 28.1 bits (61), Expect = 5.9 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 6/54 (11%) Frame = +3 Query: 159 GVSTLYMGEK------HIYIRLAQTLTKHAVDNFHFPEDYRSPILDHLPCISDV 302 G ++ Y GE+ H L Q + K D + EDY + + +H+P D+ Sbjct: 147 GTASEYRGERVLSEKLHDLSILYQQMEKSLADQYLHSEDYLTLLAEHIPLAEDI 200
>PIP_AERSO (P46547) Proline iminopeptidase (EC 3.4.11.5) (PIP) (Prolyl| aminopeptidase) (PAP) Length = 424 Score = 27.7 bits (60), Expect = 7.7 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -1 Query: 288 MEGGPGSGFGNPPENGNYLQRA 223 ++GGPG G P NG +++RA Sbjct: 56 LQGGPGFGAPRPSANGGWIKRA 77
>ERRFI_HUMAN (Q9UJM3) ERBB receptor feedback inhibitor 1 (Mitogen-inducible gene| 6 protein) (Mig-6) Length = 462 Score = 27.7 bits (60), Expect = 7.7 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 248 SGGLPKPDPGPPSMHQR 298 +GG+P P+P PP H+R Sbjct: 229 NGGVPDPNPPPPQTHRR 245
>TYDC2_PAPSO (P54769) Tyrosine/DOPA decarboxylase 2 [Includes: DOPA| decarboxylase (EC 4.1.1.28) (DDC); Tyrosine decarboxylase (EC 4.1.1.25)] Length = 531 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 308 EHHVADAWKVVQDRASVILRK 246 E HV AWK++Q+ A +IL K Sbjct: 503 ERHVIYAWKILQEHADLILGK 523
>TYDC1_PAPSO (P54768) Tyrosine/DOPA decarboxylase 1 [Includes: DOPA| decarboxylase (EC 4.1.1.28) (DDC); Tyrosine decarboxylase (EC 4.1.1.25)] Length = 518 Score = 27.3 bits (59), Expect = 10.0 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -2 Query: 308 EHHVADAWKVVQDRASVIL 252 E HV AWKVVQ+ IL Sbjct: 492 ERHVTGAWKVVQEHTDAIL 510
>DHPS_NEIMB (Q51161) Dihydropteroate synthase (EC 2.5.1.15) (DHPS)| (Dihydropteroate pyrophosphorylase) Length = 285 Score = 27.3 bits (59), Expect = 10.0 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = -1 Query: 306 APRR*CMEGGPGSGFGNPPENGNYLQR--AWLMFERGEYIYVSLPCKAYLPQQT 151 AP+R ++ G GSGFG P ++ L R LM E G + + + K+ + + T Sbjct: 183 APQRIILDPGFGSGFGKPLQHNIALMRHLPELMAETGFPLLIGVSRKSTIGELT 236 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,791,026 Number of Sequences: 219361 Number of extensions: 986658 Number of successful extensions: 2555 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 2446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2554 length of database: 80,573,946 effective HSP length: 78 effective length of database: 63,463,788 effective search space used: 1523130912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
