| Clone Name | rbart43h07 |
|---|---|
| Clone Library Name | barley_pub |
>POLG_RTSVA (Q83034) Genome polyprotein [Contains: Putative leader protein;| Coat protein 1 (25 kDa protein) (CP-1); Coat protein 2 (26 kDa protein) (CP-2); Coat protein 3 (35 kDa protein) (CP-3); Putative helicase (EC 3.6.1.-) (Putative NTP-binding protei Length = 3473 Score = 29.6 bits (65), Expect = 1.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 181 GVRCLHQKRMLGKSTLYRNYC 243 GVRC HQ + GK+ ++ NYC Sbjct: 24 GVRCAHQGWVSGKAVVFCNYC 44
>POLG_RTSVT (Q91PP5) Genome polyprotein [Contains: Putative leader protein;| Coat protein 1 (25 kDa protein) (CP-1); Coat protein 2 (26 kDa protein) (CP-2); Coat protein 3 (35 kDa protein) (CP-3); Putative helicase (EC 3.6.1.-) (Putative NTP-binding protei Length = 3471 Score = 29.6 bits (65), Expect = 1.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 181 GVRCLHQKRMLGKSTLYRNYC 243 GVRC HQ + GK+ ++ NYC Sbjct: 24 GVRCAHQGWVSGKAVVFCNYC 44
>MICA2_HUMAN (O94851) Protein MICAL-2| Length = 1124 Score = 28.9 bits (63), Expect = 3.2 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 5/58 (8%) Frame = +1 Query: 193 LHQKRMLGKSTLYRNYCLSNVKKIKVRQ---ILRRAG--LGTDFSCSSSFLPL*APPE 351 +H R LG Y +C ++ I +RQ IL + LG + + F+ + PPE Sbjct: 134 IHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHVNVEFVKVLEPPE 191
>MBHA_ECOLI (Q47154) Protein mbhA| Length = 211 Score = 28.5 bits (62), Expect = 4.2 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 196 HQKRMLGKSTLYRNYCLSNVKKIKVRQILRRAGLGTD 306 H M K+ +Y N+ LS + + R++L AG+ D Sbjct: 105 HTDAMAYKNNIYNNWNLSGDRALSARRVLEEAGMPED 141
>RBL_METMA (Q8PXG9) Ribulose bisphosphate carboxylase (EC 4.1.1.39) (RuBisCO)| Length = 428 Score = 28.5 bits (62), Expect = 4.2 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = +3 Query: 42 HNLSRIRGQCI*GKLPSNDSGHILELK---LNPMIVNVLRTLPPT 167 H + +R QC+ K+P+++S HIL L PM L PT Sbjct: 316 HEVLNLRDQCVLDKVPADESQHILAQDWRGLKPMFPVASGGLAPT 360
>PR2_DROME (Q9I7F7) Tyrosine-protein kinase PR2 (EC 2.7.10.2)| Length = 1337 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = +1 Query: 178 SGVRCLHQKRMLGKSTLYRNYCLSNVKKIKVRQ--ILRRAGLGTDF 309 +G+R L QKR++ + RN + + K+K+ + R G+G D+ Sbjct: 246 NGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDY 291
>ADT_ORYSA (P31691) ADP,ATP carrier protein, mitochondrial precursor (ADP/ATP| translocase) (Adenine nucleotide translocator) (ANT) Length = 382 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 371 FFGKKYGSGGA 339 FFGKKYGSGGA Sbjct: 372 FFGKKYGSGGA 382
>MICA2_MOUSE (Q8BML1) Protein MICAL-2| Length = 960 Score = 28.1 bits (61), Expect = 5.4 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 5/58 (8%) Frame = +1 Query: 193 LHQKRMLGKSTLYRNYCLSNVKKIKVRQ---ILRRAG--LGTDFSCSSSFLPL*APPE 351 +H R LG Y +C ++ I +RQ IL + LG + + F+ + PPE Sbjct: 134 IHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEVHVNVEFVRVLEPPE 191
>ADT2_WHEAT (Q41630) ADP,ATP carrier protein 2, mitochondrial precursor| (ADP/ATP translocase 2) (Adenine nucleotide translocator 2) (ANT 2) Length = 331 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 371 FFGKKYGSGGA 339 FFGKKYGSGGA Sbjct: 321 FFGKKYGSGGA 331
>ADT1_WHEAT (Q41629) ADP,ATP carrier protein 1, mitochondrial precursor| (ADP/ATP translocase 1) (Adenine nucleotide translocator 1) (ANT 1) Length = 331 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 371 FFGKKYGSGGA 339 FFGKKYGSGGA Sbjct: 321 FFGKKYGSGGA 331
>ADT2_MAIZE (P12857) ADP,ATP carrier protein 2, mitochondrial precursor| (ADP/ATP translocase 2) (Adenine nucleotide translocator 2) (ANT 2) Length = 387 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 371 FFGKKYGSGGA 339 FFGKKYGSGGA Sbjct: 377 FFGKKYGSGGA 387
>ADT1_MAIZE (P04709) ADP,ATP carrier protein 1, mitochondrial precursor| (ADP/ATP translocase 1) (Adenine nucleotide translocator 1) (ANT 1) Length = 387 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 371 FFGKKYGSGGA 339 FFGKKYGSGGA Sbjct: 377 FFGKKYGSGGA 387
>DHCR7_BOVIN (Q5E9J5) 7-dehydrocholesterol reductase (EC 1.3.1.21) (7-DHC| reductase) (Sterol delta-7-reductase) Length = 475 Score = 27.7 bits (60), Expect = 7.1 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -3 Query: 268 LLSF*RWRGNNFCRGWIFPTFVFGGGIELQRLS*VGGSVLKTFTII 131 LL+ W N GW PT +F I L + + G + TF ++ Sbjct: 152 LLTHLLWFANAHLLGWFSPTIIFDNWIPLLWCANILGYTVSTFAMV 197
>APOA4_MOUSE (P06728) Apolipoprotein A-IV precursor (Apo-AIV) (ApoA-IV)| Length = 395 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 111 LELKLNPMIVNVLRTLPPTYDNLWSSMPPPKTNV 212 ++L+L P I + T+ DNL +SM P TN+ Sbjct: 153 MKLQLTPYIQRMQTTIKENVDNLHTSMMPLATNL 186
>REPA_BACSU (P13962) Protein repA| Length = 396 Score = 27.3 bits (59), Expect = 9.3 Identities = 18/60 (30%), Positives = 26/60 (43%) Frame = +3 Query: 138 VNVLRTLPPTYDNLWSSMPPPKTNVGKIHXXXXXXXXXXXXDKSSPDPPKGRTGNRLLLF 317 V V + P Y N+++++ TNV D+ + P GRT NR LLF Sbjct: 205 VTVSKIKPNNYSNIFNNLSNISTNVSN--------NLLIDDDEEIENEPTGRTINRSLLF 256
>KV6A_MOUSE (P01675) Ig kappa chain V-VI region XRPC 44| Length = 107 Score = 27.3 bits (59), Expect = 9.3 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -3 Query: 235 FCRGWIFPTFVFGGGIELQ 179 +C+ W +P + FGGG +L+ Sbjct: 86 YCQQWNYPLWTFGGGTKLE 104
>MICA3_MOUSE (Q8CJ19) Protein MICAL-3| Length = 864 Score = 27.3 bits (59), Expect = 9.3 Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = +1 Query: 193 LHQKRMLGKSTLYRNYCLSNVKKIKVRQ---ILRRAG--LGTDFSCSSSFLPL*APPE 351 +H R LG Y +C + I +RQ IL + LG + + F L PPE Sbjct: 134 IHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHVNVEFQGLVQPPE 191
>MICA3_HUMAN (Q7RTP6) Protein MICAL-3| Length = 976 Score = 27.3 bits (59), Expect = 9.3 Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = +1 Query: 193 LHQKRMLGKSTLYRNYCLSNVKKIKVRQ---ILRRAG--LGTDFSCSSSFLPL*APPE 351 +H R LG Y +C + I +RQ IL + LG + + F L PPE Sbjct: 134 IHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHVNVEFQGLIQPPE 191 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,302,304 Number of Sequences: 219361 Number of extensions: 1309560 Number of successful extensions: 2939 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 2896 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2939 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)