Clone Name | rbart43f10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VGP_EBOG4 (O11457) Structural glycoprotein precursor (Virion spi... | 29 | 3.9 | 2 | VGP_EBOZ5 (P87666) Structural glycoprotein precursor (Virion spi... | 28 | 6.6 |
---|
>VGP_EBOG4 (O11457) Structural glycoprotein precursor (Virion spike| glycoprotein) [Contains: GP1; GP2] Length = 676 Score = 28.9 bits (63), Expect = 3.9 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 91 TGVHTHNVDKVNLVKPRHRNTDNIHTKKET*PDTTS 198 T V+ ++ + V+ HR TDN T +T P TT+ Sbjct: 391 TPVYKLDISEATQVEQHHRRTDNASTTSDTPPATTA 426
>VGP_EBOZ5 (P87666) Structural glycoprotein precursor (Virion spike| glycoprotein) [Contains: GP1; GP2] Length = 676 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 91 TGVHTHNVDKVNLVKPRHRNTDNIHTKKET*PDTTS 198 T V+ ++ + V+ HR TDN T +T P TT+ Sbjct: 391 TPVYKLDISEATQVEQHHRRTDNDSTASDTPPATTA 426 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,583,342 Number of Sequences: 219361 Number of extensions: 476912 Number of successful extensions: 1168 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1168 length of database: 80,573,946 effective HSP length: 41 effective length of database: 71,580,145 effective search space used: 1717923480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)