Clone Name | rbart43e08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | COX12_YEAST (Q01519) Cytochrome c oxidase polypeptide VIb (EC 1.... | 30 | 1.9 | 2 | POLG_BTMV (Q6XW15) Genome polyprotein [Contains: P1 proteinase (... | 28 | 7.1 | 3 | SYI_GEOSL (Q747X9) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isole... | 28 | 9.2 |
---|
>COX12_YEAST (Q01519) Cytochrome c oxidase polypeptide VIb (EC 1.9.3.1) (AED)| Length = 82 Score = 30.0 bits (66), Expect = 1.9 Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +1 Query: 28 YKFCTNYYNPD--TCTVYWKTTTELDNISWVKNW 123 Y C N D C V+WKT L + W++ W Sbjct: 33 YHKCVNMKGEDFAPCKVFWKTYNALCPLDWIEKW 66
>POLG_BTMV (Q6XW15) Genome polyprotein [Contains: P1 proteinase (N-terminal| protein); Helper component proteinase (EC 3.4.22.45) (HC-pro); Protein P3; 6 kDa protein 1 (6K1); Cytoplasmic inclusion protein (EC 3.6.1.-) (CI); 6 kDa protein 2 (6K2); Viral gen Length = 3085 Score = 28.1 bits (61), Expect = 7.1 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 43 NYYNPDTCTVYWKTTTELDNISWVKNWGH 129 NY+ P T K + ++++ WVK+W H Sbjct: 2224 NYFVPFTDDFQSKYLSNIESLEWVKHWRH 2252
>SYI_GEOSL (Q747X9) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 923 Score = 27.7 bits (60), Expect = 9.2 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 79 KTTTELDNISWVKNWG 126 K TE+D +SWV WG Sbjct: 427 KALTEIDRVSWVPKWG 442 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,637,243 Number of Sequences: 219361 Number of extensions: 273494 Number of successful extensions: 901 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 901 length of database: 80,573,946 effective HSP length: 18 effective length of database: 76,625,448 effective search space used: 1839010752 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)