Clone Name | rbart43e06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UL52_EBV (P03193) Helicase/primase complex protein (Probable DNA... | 31 | 0.90 | 2 | NUOA_BUCBP (Q89AU6) NADH-quinone oxidoreductase chain A (EC 1.6.... | 28 | 4.5 | 3 | MATK_PSEMZ (Q9MV48) Maturase K (Intron maturase) | 27 | 10.0 | 4 | MATK_THUDO (Q9MSS0) Maturase K (Intron maturase) | 27 | 10.0 | 5 | RNAS1_MICNV (Q9WUV3) Ribonuclease pancreatic precursor (EC 3.1.2... | 27 | 10.0 |
---|
>UL52_EBV (P03193) Helicase/primase complex protein (Probable DNA replication| protein BSLF1) Length = 874 Score = 30.8 bits (68), Expect = 0.90 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -2 Query: 229 SKHVRTYVRRRTALAMHITHANVRTRMEHLLFFRWIGSP 113 ++H+RTY R T LA H+ ++ RME + W P Sbjct: 312 AEHMRTYFTRETYLAEHVRVQQLKIRMEPPAPYTWDPDP 350
>NUOA_BUCBP (Q89AU6) NADH-quinone oxidoreductase chain A (EC 1.6.99.5) (NADH| dehydrogenase I, chain A) (NDH-1, chain A) Length = 132 Score = 28.5 bits (62), Expect = 4.5 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -3 Query: 90 WGFLAFFFVVIKTCVIMIMLA 28 W F FFF+ + CV M+ ++ Sbjct: 12 WAFFTFFFIAVSICVFMLSIS 32
>MATK_PSEMZ (Q9MV48) Maturase K (Intron maturase)| Length = 515 Score = 27.3 bits (59), Expect = 10.0 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 8/53 (15%) Frame = -2 Query: 211 YVR--RRTALAMHITHANVRTRMEHLLFFR------WIGSPHRMCTFYVGLSC 77 YVR R+ +A+ TH V+ HLL FR W P+R+C+ + +C Sbjct: 274 YVRYGERSIIAIKGTHLLVKKCRYHLLIFRQCYFHLWF-EPYRVCSHQLSKNC 325
>MATK_THUDO (Q9MSS0) Maturase K (Intron maturase)| Length = 509 Score = 27.3 bits (59), Expect = 10.0 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 7/57 (12%) Frame = -2 Query: 211 YVR--RRTALAMHITHANVRTRMEHLL-----FFRWIGSPHRMCTFYVGLSCFFFCG 62 YVR R+ +A+ TH V+ HL FF P+R+C+ + + F F G Sbjct: 275 YVRYGERSLIALKGTHLQVKKCRYHLFHFWQYFFHLWFQPYRICSLELSKTSFSFLG 331
>RNAS1_MICNV (Q9WUV3) Ribonuclease pancreatic precursor (EC 3.1.27.5) (RNase 1)| (RNase A) Length = 148 Score = 27.3 bits (59), Expect = 10.0 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -3 Query: 246 QGSCPKVSTYVRTYDDALHLPCISRMQTYVHAWNICYSFDGSGLLTVC 103 QG C V+T+V A+H C + T + + CY + +T C Sbjct: 61 QGYCKPVNTFVHEPQTAVHAVCSQKNVTCKNGNSNCYKSHSALHITDC 108 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,907,957 Number of Sequences: 219361 Number of extensions: 912948 Number of successful extensions: 1944 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1943 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)