Clone Name | rbart43e05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Z585B_PONPY (Q5RB30) Zinc finger protein 585B | 30 | 1.4 | 2 | Z585B_HUMAN (Q52M93) Zinc finger protein 585B (zinc finger prote... | 30 | 1.8 | 3 | EURL_MOUSE (Q9D7G4) Protein EURL homolog | 30 | 2.3 | 4 | GPA6_CAEEL (Q93743) Guanine nucleotide-binding protein alpha-6 s... | 28 | 5.1 |
---|
>Z585B_PONPY (Q5RB30) Zinc finger protein 585B| Length = 769 Score = 30.4 bits (67), Expect = 1.4 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 118 WMHLDLQEKN*FRDEVLKTRRH 183 W HLDL ++N +RD +L+T H Sbjct: 41 WQHLDLSQRNLYRDVMLETYSH 62
>Z585B_HUMAN (Q52M93) Zinc finger protein 585B (zinc finger protein 41-like| protein) Length = 769 Score = 30.0 bits (66), Expect = 1.8 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 118 WMHLDLQEKN*FRDEVLKTRRH 183 W HLDL ++N +RD +L+T H Sbjct: 41 WRHLDLSQRNLYRDVMLETYSH 62
>EURL_MOUSE (Q9D7G4) Protein EURL homolog| Length = 290 Score = 29.6 bits (65), Expect = 2.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 7 KANWSFIYSMEKLLQLATQCNKPSRHAL 90 K NW Y+ K L L ++C+K S+H L Sbjct: 93 KINWIVQYAQNKNLDLESECSKTSQHPL 120
>GPA6_CAEEL (Q93743) Guanine nucleotide-binding protein alpha-6 subunit| Length = 364 Score = 28.5 bits (62), Expect = 5.1 Identities = 18/38 (47%), Positives = 22/38 (57%) Frame = +1 Query: 22 FIYSMEKLLQLATQCNKPSRHALKQQESIFKTWMHLDL 135 FI SM QL + NK +R +KQ IFKT +H DL Sbjct: 234 FIVSMSDYDQLDPEDNKYNR--MKQSYEIFKTIVHSDL 269 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,781,967 Number of Sequences: 219361 Number of extensions: 311739 Number of successful extensions: 810 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 800 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 810 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)