| Clone Name | rbart43d10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CD2A2_RAT (Q8QZZ9) Cyclin-dependent kinase inhibitor 2A, isoform... | 29 | 2.9 | 2 | APOH_CANFA (P33703) Beta-2-glycoprotein 1 precursor (Beta-2-glyc... | 28 | 6.6 | 3 | TOM1_ASHGO (Q756G2) Probable E3 ubiquitin protein ligase TOM1 (E... | 28 | 8.6 | 4 | TOM1_YEAST (Q03280) E3 ubiquitin protein ligase TOM1 (EC 6.3.2.-... | 28 | 8.6 |
|---|
>CD2A2_RAT (Q8QZZ9) Cyclin-dependent kinase inhibitor 2A, isoform 2 (p19ARF)| Length = 160 Score = 29.3 bits (64), Expect = 2.9 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 64 QIRTPYHPFRSNAKRRANELKQESTSTVP 150 ++R P+HP + A+R A L + S ST P Sbjct: 84 ELRGPHHPLPTGARRSAGGLPRHSGSTAP 112
>APOH_CANFA (P33703) Beta-2-glycoprotein 1 precursor (Beta-2-glycoprotein I)| (Apolipoprotein H) (Apo-H) (B2GPI) (Beta(2)GPI) Length = 345 Score = 28.1 bits (61), Expect = 6.6 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 165 YWCGDGNCRRGLLFQFVSPALGI*PERVIRC 73 Y C G RGL +F P G+ P +RC Sbjct: 49 YTCQPGYVFRGLTRRFTCPLTGVWPTNTVRC 79
>TOM1_ASHGO (Q756G2) Probable E3 ubiquitin protein ligase TOM1 (EC 6.3.2.-)| Length = 3258 Score = 27.7 bits (60), Expect = 8.6 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 6/32 (18%) Frame = -3 Query: 192 SLQCFGRKLYWCGD------GNCRRGLLFQFV 115 +L+C K WC D GN GLLFQ + Sbjct: 350 ALECISLKHVWCSDIVRNLGGNMSHGLLFQIL 381
>TOM1_YEAST (Q03280) E3 ubiquitin protein ligase TOM1 (EC 6.3.2.-)| (Temperature-dependent organization in mitotic nucleus protein 1) (Suppressor of snRNA protein 2) Length = 3268 Score = 27.7 bits (60), Expect = 8.6 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 6/32 (18%) Frame = -3 Query: 192 SLQCFGRKLYWCGD------GNCRRGLLFQFV 115 +L+C K WC D GN GLLFQ + Sbjct: 351 TLECISLKHVWCSDIIRNLGGNISHGLLFQIL 382 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,346,750 Number of Sequences: 219361 Number of extensions: 486998 Number of successful extensions: 1365 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1357 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1365 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)