| Clone Name | rbart43d05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HMCS2_PIG (O02734) Hydroxymethylglutaryl-CoA synthase, mitochond... | 32 | 0.97 | 2 | LAMA1_HUMAN (P25391) Laminin alpha-1 chain precursor (Laminin A ... | 30 | 2.2 | 3 | RIHC_ECOL6 (P0C0W2) Nonspecific ribonucleoside hydrolase rihC (E... | 29 | 6.3 | 4 | UBP26_MOUSE (Q99MX1) Ubiquitin carboxyl-terminal hydrolase 26 (E... | 29 | 6.3 |
|---|
>HMCS2_PIG (O02734) Hydroxymethylglutaryl-CoA synthase, mitochondrial| precursor (EC 2.3.3.10) (HMG-CoA synthase) (3-hydroxy-3-methylglutaryl coenzyme A synthase) Length = 508 Score = 31.6 bits (70), Expect = 0.97 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 21 NLKCSCIYKCLESMLSQCCLSCAEFTPIGCFALGS 125 N+ S +Y CL S+LSQC + IG F+ GS Sbjct: 380 NMYTSSLYGCLASLLSQCSAQDLAGSRIGAFSYGS 414
>LAMA1_HUMAN (P25391) Laminin alpha-1 chain precursor (Laminin A chain)| Length = 3075 Score = 30.4 bits (67), Expect = 2.2 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = -3 Query: 307 SCMDSQCAKGPCICKEAADGTL--RIEPEVYSESLSRSVMVQVNSHGQSIFFCF 152 S D C GPC+CKE +G R +P Y+ + + N G S FCF Sbjct: 461 SASDEPCT-GPCVCKENVEGKACDRCKPGFYN-------LKEKNPRGCSECFCF 506
>RIHC_ECOL6 (P0C0W2) Nonspecific ribonucleoside hydrolase rihC (EC 3.2.-.-)| (Purine/pyrimidine ribonucleoside hydrolase) Length = 304 Score = 28.9 bits (63), Expect = 6.3 Identities = 16/30 (53%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -1 Query: 450 LVHPEYFTFKKGVVRVETQG-ICTGHTLMD 364 LV PE FT K V VETQG +G T++D Sbjct: 241 LVRPELFTLKPCFVAVETQGEFTSGTTVVD 270
>UBP26_MOUSE (Q99MX1) Ubiquitin carboxyl-terminal hydrolase 26 (EC 3.1.2.15)| (Ubiquitin thioesterase 26) (Ubiquitin-specific-processing protease 26) (Deubiquitinating enzyme 26) Length = 835 Score = 28.9 bits (63), Expect = 6.3 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -3 Query: 391 HLHRPYFDGSWIEKVEFRKSMVGLCTNFSCMDSQCAKGP 275 HL R +F+ SW+ K + R +V SC S+ K P Sbjct: 510 HLKRYHFNESWVMKKDERPILVSKYLRLSCHCSKSTKPP 548 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,797,629 Number of Sequences: 219361 Number of extensions: 1408117 Number of successful extensions: 3784 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3781 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)