Clone Name | rbart43b10 |
---|---|
Clone Library Name | barley_pub |
>LONH1_THEAC (Q9HJ89) Putative protease La homolog type 1 (EC 3.4.21.-)| Length = 657 Score = 28.9 bits (63), Expect = 3.5 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -3 Query: 186 KKERGKKLLPLDLHVEYVGGTRGREGHAKS 97 KK GK + +D+H+++VG G EG + S Sbjct: 498 KKLTGKDISNMDIHIQFVGTYEGVEGDSAS 527
>LONH1_THEVO (P58274) Putative protease La homolog type 1 (EC 3.4.21.-)| Length = 655 Score = 28.9 bits (63), Expect = 3.5 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -3 Query: 186 KKERGKKLLPLDLHVEYVGGTRGREGHAKS 97 KK GK + +D+H+++VG G EG + S Sbjct: 498 KKITGKDISNMDIHIQFVGTYEGVEGDSAS 527
>RPOM_HUMAN (O00411) DNA-directed RNA polymerase, mitochondrial precursor (EC| 2.7.7.6) (MtRPOL) Length = 1230 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -2 Query: 289 PLPTEGHLPHLSAPSLLAQVFRRALA 212 P P E HLPH +AP+ A++ RR LA Sbjct: 739 PQPPEAHLPHSAAPARKAEL-RRELA 763
>ORN_VIBCH (Q9KV17) Oligoribonuclease (EC 3.1.-.-)| Length = 181 Score = 28.1 bits (61), Expect = 5.9 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 98 LPRSISFLYFYRIDFTGLKRLGRKWQESVL 9 +PR ++ ++ ID + +K L R+WQ VL Sbjct: 120 MPRLEAYFHYRYIDVSTIKELTRRWQPEVL 149
>CX036_HUMAN (Q9H7Y0) Protein CXorf36 precursor| Length = 182 Score = 27.7 bits (60), Expect = 7.7 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = +1 Query: 46 RPVKSMR*--KYRKEILRGRLCVSLSTPRTTNVLYVQVKGQ*F 168 RPV+ R KY+ EI R+C S S P+T ++ V K + F Sbjct: 109 RPVEIFRLVSKYQNEISDRRICASASAPKTCSIERVLRKTERF 151
>TLR4_PIG (Q68Y56) Toll-like receptor 4 precursor (CD284 antigen)| Length = 841 Score = 27.7 bits (60), Expect = 7.7 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 134 LVVRGVERDTQSLPRSISFLYFYRIDFT 51 L+V E++ Q LPRS++FL + DF+ Sbjct: 555 LIVASKEQELQHLPRSLAFLNLTKNDFS 582
>GSHB_SYNPX (Q7U3W8) Glutathione synthetase (EC 6.3.2.3) (Glutathione synthase)| (GSH synthetase) (GSH-S) (GSHase) Length = 307 Score = 27.7 bits (60), Expect = 7.7 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +3 Query: 207 NRASARRNTWARRLGALRWGRW 272 NR SA R W +LGALR+ RW Sbjct: 109 NRPSALR-AWNEKLGALRFSRW 129
>LONH_ARCFU (O29883) Putative protease La homolog type (EC 3.4.21.-)| Length = 621 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -3 Query: 186 KKERGKKLLPLDLHVEYVGGTRGREGHAKS 97 KK G+ + +D+H+++VG G EG + S Sbjct: 482 KKYTGRDISNMDVHIQFVGTYEGVEGDSAS 511 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,516,406 Number of Sequences: 219361 Number of extensions: 648656 Number of successful extensions: 1611 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1611 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)