Clone Name | rbart43b07 |
---|---|
Clone Library Name | barley_pub |
>ANGLT_ROSHC (Q4R1I9) Anthocyanidin 5,3-O-glucosyltransferase (EC 2.4.1.-)| (UDP-glucose: anthocyanidin 5,3-O-glucosyltransferase) Length = 473 Score = 33.9 bits (76), Expect = 0.18 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -3 Query: 342 MMDSDGGRVIRERTQAAMRQANEAMREGGQSEATLARLVDAW 217 +MDS+ G IR R +A EGG S A+LA+L W Sbjct: 429 LMDSESGDEIRGRVSEFSNGGVKAKEEGGSSVASLAKLAQLW 470
>JHD1_CRYNE (Q55NZ6) JmjC domain-containing histone demethylation protein 1 (EC| 1.14.11.-) Length = 879 Score = 31.6 bits (70), Expect = 0.89 Identities = 20/61 (32%), Positives = 27/61 (44%) Frame = +2 Query: 86 RENPSTVVVYFRSNLILPHTTMLVAHRVSPDLFFNRSREHQASSHASTSRANVASDCPPS 265 + + ST +SN+ P T+ SP++ RE QA S A T ASD P Sbjct: 152 KRSASTSAPLLKSNIKRPRTSTKGQETASPEIDMKSEREQQAESTAGTP----ASDAPQG 207 Query: 266 R 268 R Sbjct: 208 R 208
>TORZ_ECOL6 (Q8CVZ3) Trimethylamine-N-oxide reductase 2 precursor (EC 1.7.2.3)| (TMAO reductase 2) (Trimethylamine oxidase 2) Length = 809 Score = 30.0 bits (66), Expect = 2.6 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = -3 Query: 324 GRVIRERTQAAMRQANEAMREGGQSEATLARLVDA 220 G V+ E + A QA+EA +GG + +AR+VDA Sbjct: 401 GGVLPEMSAAIAGQASEAADDGGMTAIPVARIVDA 435
>TORZ_ECO57 (P58362) Trimethylamine-N-oxide reductase 2 precursor (EC 1.7.2.3)| (TMAO reductase 2) (Trimethylamine oxidase 2) Length = 809 Score = 30.0 bits (66), Expect = 2.6 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = -3 Query: 324 GRVIRERTQAAMRQANEAMREGGQSEATLARLVDA 220 G V+ E + A QA+EA +GG + +AR+VDA Sbjct: 401 GGVLPEMSAAIAGQASEAADDGGMTAIPVARIVDA 435
>TCTP_WUCBA (Q962A2) Translationally-controlled tumor protein homolog (TCTP)| Length = 181 Score = 30.0 bits (66), Expect = 2.6 Identities = 14/40 (35%), Positives = 27/40 (67%), Gaps = 3/40 (7%) Frame = -3 Query: 291 MRQANEAMREGGQSEATLA---RLVDAWLLA*CSRDRLKK 181 M++ E M++ G+SEA ++ R + AW+++ S+DR K+ Sbjct: 96 MKKVVELMQKNGKSEAEISEFKRKIQAWVVSLLSKDRFKQ 135
>TCTP_BRUMA (P90697) Translationally-controlled tumor protein homolog (TCTP)| (TPH-1) Length = 181 Score = 29.6 bits (65), Expect = 3.4 Identities = 14/40 (35%), Positives = 27/40 (67%), Gaps = 3/40 (7%) Frame = -3 Query: 291 MRQANEAMREGGQSEATLA---RLVDAWLLA*CSRDRLKK 181 M++ E M++ G+SEA ++ R + AW+++ S+DR K+ Sbjct: 96 MKKVVELMQKNGKSEAEISEFKRKIPAWVVSLLSKDRFKQ 135
>TORZ_ECOLI (P46923) Trimethylamine-N-oxide reductase 2 precursor (EC 1.7.2.3)| (TMAO reductase 2) (Trimethylamine oxidase 2) Length = 809 Score = 28.1 bits (61), Expect = 9.9 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -3 Query: 324 GRVIRERTQAAMRQANEAMREGGQSEATLARLVDA 220 G V+ E + A A+EA +GG + +AR+VDA Sbjct: 401 GGVLPEMSAAIAGHASEAADDGGMTAIPVARIVDA 435
>KCNH6_RAT (O54853) Potassium voltage-gated channel subfamily H member 6| (Voltage-gated potassium channel subunit Kv11.2) (Ether-a-go-go-related gene potassium channel 2) (Ether-a-go-go-related protein 2) (Eag-related protein 2) Length = 950 Score = 28.1 bits (61), Expect = 9.9 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +2 Query: 254 CPPSRIASFACLMAACVRSRIT-LPPSESIIH 346 CP R AS CL A V+ + T PP ++++H Sbjct: 592 CPAFRGASKGCLRALAVKFKTTHAPPGDTLVH 623 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,601,007 Number of Sequences: 219361 Number of extensions: 818244 Number of successful extensions: 2032 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1963 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2032 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)