| Clone Name | rbart43a08 |
|---|---|
| Clone Library Name | barley_pub |
>TR150_XENLA (Q5BJ39) Thyroid hormone receptor-associated protein 3 (Thyroid| hormone receptor-associated protein complex 150 kDa component) (Trap150) Length = 951 Score = 30.0 bits (66), Expect = 2.4 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 303 LDISEFLNLNNHGGKARSFFSVRIRSWSWGWG 398 L +F+ N GG+AR F R R WG G Sbjct: 811 LGTKDFVGPNERGGRARGTFQFRARGRGWGRG 842
>TR150_RAT (Q5M7V8) Thyroid hormone receptor-associated protein 3 (Thyroid| hormone receptor-associated protein complex 150 kDa component) (Trap150) Length = 951 Score = 30.0 bits (66), Expect = 2.4 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 303 LDISEFLNLNNHGGKARSFFSVRIRSWSWGWG 398 L +F+ N GG+AR F R R WG G Sbjct: 811 LGTKDFVGPNERGGRARGTFQFRARGRGWGRG 842
>TR150_MOUSE (Q569Z6) Thyroid hormone receptor-associated protein 3 (Thyroid| hormone receptor-associated protein complex 150 kDa component) (Trap150) Length = 951 Score = 30.0 bits (66), Expect = 2.4 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 303 LDISEFLNLNNHGGKARSFFSVRIRSWSWGWG 398 L +F+ N GG+AR F R R WG G Sbjct: 811 LGTKDFVGPNERGGRARGTFQFRARGRGWGRG 842
>VE2_HPV39 (P24830) Regulatory protein E2| Length = 370 Score = 29.6 bits (65), Expect = 3.2 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +1 Query: 133 SITSRRVKDVLQKN*QSHVKAQQPWEQKTLQPTGDPGRRRPRHCRET 273 S+ + + L +H A P QKT+ P P R+RPR C T Sbjct: 212 SVPTTELTTELSNTTATHSTATTPCTQKTIPP---PSRKRPRQCAVT 255
>PUR4_HUMAN (O15067) Phosphoribosylformylglycinamidine synthase (EC 6.3.5.3)| (FGAM synthase) (FGAMS) (Formylglycinamide ribotide amidotransferase) (FGARAT) (Formylglycinamide ribotide synthetase) Length = 1338 Score = 26.2 bits (56), Expect(2) = 6.4 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 Query: 372 IRSWSWGWGRIPLDKVTT 425 +R W W W P D +TT Sbjct: 1302 VRPWQWAWRPPPFDTLTT 1319 Score = 20.8 bits (42), Expect(2) = 6.4 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 202 PWEQKTLQPTGDPG 243 P EQ L P G PG Sbjct: 1266 PTEQYPLNPNGSPG 1279
>IF2_ERWCT (Q6D9A5) Translation initiation factor IF-2| Length = 900 Score = 28.5 bits (62), Expect = 7.1 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +1 Query: 142 SRRVKDVLQK--N*QSHVKAQQPWEQKTLQPTGDPGRRRPRHCRETFNLPASVVN 300 +R K QK N QS KA + E+ G G+R+P +++FN P VN Sbjct: 265 TRAAKVTKQKKGNRQSESKADR--EEARAVTRGGKGKRKPSSLQQSFNKPVQAVN 317
>FZY1_CAEEL (Q09373) WD-repeat-containing protein fzy-1 (Fizzy protein 1)| Length = 507 Score = 28.5 bits (62), Expect = 7.1 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 14/54 (25%) Frame = +2 Query: 134 ASHLAESRMFFRK--INNRMLRPNSPGNK-----------KHYSL-LVTPADDG 253 A+HL S+++ K +NN M PNSP K +H S +T ADDG Sbjct: 63 ANHLMTSKLYSNKENLNNSMSEPNSPEKKSVEGEALKQMMRHKSTGALTDADDG 116
>RL3_WOLSU (Q7M8D4) 50S ribosomal protein L3| Length = 192 Score = 28.5 bits (62), Expect = 7.1 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -2 Query: 113 LIKYWDAKMLVVFANGNALFSFTYGKPLYKA 21 L+K DAK+ V NG AL ++ GK KA Sbjct: 23 LLKVKDAKVCEVLGNGKALVAYAQGKDANKA 53 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,157,909 Number of Sequences: 219361 Number of extensions: 976303 Number of successful extensions: 2271 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2225 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2270 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)